PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ahy001549
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family NF-YA
Protein Properties Length: 256aa    MW: 27896.5 Da    PI: 10.226
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-171a-Arachis_hypogaea-19523PU_refplantGDBView CDS
gnl|UG|Ahy#S58459754PU_unrefUnigeneView CDS
gnl|UG|Ahy#S54173122PU_unrefUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA1056.4e-3375131158
  CBFB_NFYA   1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                d p+YVNaKQy++Il+RRq+Rakle+++kl +k+rkpylheSRh+hAl+R RgsgGrF
  Ahy001549  75 DGPIYVNAKQYHGILRRRQSRAKLEAQNKL-IKNRKPYLHESRHRHALKRVRGSGGRF 131
                57****************************.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005211.0E-3673134IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115237.33874134IPR001289Nuclear transcription factor Y subunit A
PfamPF020456.3E-2877131IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006166.6E-257799IPR001289Nuclear transcription factor Y subunit A
PROSITE patternPS0068607999IPR018362CCAAT-binding factor, conserved site
PRINTSPR006166.6E-25108131IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0016602Cellular ComponentCCAAT-binding factor complex
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 256 aa     Download sequence    Send to blast
MKPFLLLNHP DPVFNFEQVN STHSMAHAPF PYSEPFFGGS LVAYGPQAVG QPQMLPQVLG  60
LGSPRIALPL DLAEDGPIYV NAKQYHGILR RRQSRAKLEA QNKLIKNRKP YLHESRHRHA  120
LKRVRGSGGR FLSAKQLQLS NSELINSARS GLNPVNVYHK KDASEVESHL SRTGENASSI  180
TTCSDLTSFS SNDINFRHPE HNFLGSSPNM GGAHNAVGDT PLVVEPSNVL HMPGERGGTK  240
ATELGSPIRA GKSSLA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A2e-2275136263NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1115124RHRHALKRVR
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016202628.11e-156nuclear transcription factor Y subunit A-3
RefseqXP_025630903.11e-156nuclear transcription factor Y subunit A-3
TrEMBLM4SZZ41e-154M4SZZ4_ARAHY; Nuclear transcription factor Y subunit A-3
STRINGXP_007154608.11e-110(Phaseolus vulgaris)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G72830.17e-47nuclear factor Y, subunit A3