PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AHYPO_022540-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Amaranthaceae; Amaranthus
Family GRAS
Protein Properties Length: 527aa    MW: 59404.7 Da    PI: 6.8393
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AHYPO_022540-RAgenomeBYUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS348.88.4e-1071765151342
             GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfs 94 
                      l++lL++cA+av+s dl++a++ L++++ ++sp+gd++qRla+yf+++L+arla+++s+++  +   + s   ss+ l+a+++++ + P++++s
  AHYPO_022540-RA 176 LRTLLTHCAQAVASFDLRAANERLKQIRLHSSPYGDSIQRLAHYFANGLEARLAGTGSTVSGNIVDARMS---SSDFLKAYRVYVSTIPWHRMS 266
                      6789***************************************************999999877766666...9******************** PP

             GRAS  95 hltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrl 186
                      +++aN+aI + +e+++r+Hi+Df++  GlQWp+L+q La+R++gpp+lRiTg++ p++g   +e++e+tg+rLa ++e+++vpf++++ +a+++
  AHYPO_022540-RA 267 YFLANNAIIKLAEKATRIHIVDFGVLLGLQWPCLIQNLAKRSNGPPRLRITGIDYPQQGfrPAERVEATGRRLAGYCERFNVPFQYQA-IANKW 359
                      **********************************************************9*****************************.7**** PP

             GRAS 187 edleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklprese 280
                      +++++e+++++ +E ++Vn++++  +llde+v+++s++d++L+l+k+l+P ++++   +  +n++ F +rf eal ++s++fd +e++ pre++
  AHYPO_022540-RA 360 DCIKPEDINIEDDELVIVNCMFRSGTLLDETVEVDSQKDAFLRLIKQLNPSLFIHGIVNGTYNAPFFITRFREALFHFSSVFDIFEETNPREEH 453
                      *************************************************************************************9999***** PP

             GRAS 281 erikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllr 342
                      er  +E el +re+ nv+acegaer++r et+++W++r  +aGFk++pl+ +   +ak++++
  AHYPO_022540-RA 454 ERLLIESELNAREALNVIACEGAERIQRPETYKQWQARTVRAGFKQLPLDRNLLGKAKAMVE 515
                      ******************************************************99999876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098562.52150526IPR005202Transcription factor GRAS
PfamPF035142.9E-104176515IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 527 aa     Download sequence    Send to blast
MKFLLLIESP DDNGVDGYFL SNTPSFESNW VQNQIQLEPV INLSDHSNSN SEVKSQSSGS  60
NNSDGCIDGL ATSTSSTLTS IAQAKVDNGV SQSRKKKNQR RDDGDNDGGR SNKQQASSNE  120
DYVEMRQYDD ILLCREDKYD LTNCDKEVNK KSQGKDTKSK TSRGKKQNNA VEEVDLRTLL  180
THCAQAVASF DLRAANERLK QIRLHSSPYG DSIQRLAHYF ANGLEARLAG TGSTVSGNIV  240
DARMSSSDFL KAYRVYVSTI PWHRMSYFLA NNAIIKLAEK ATRIHIVDFG VLLGLQWPCL  300
IQNLAKRSNG PPRLRITGID YPQQGFRPAE RVEATGRRLA GYCERFNVPF QYQAIANKWD  360
CIKPEDINIE DDELVIVNCM FRSGTLLDET VEVDSQKDAF LRLIKQLNPS LFIHGIVNGT  420
YNAPFFITRF REALFHFSSV FDIFEETNPR EEHERLLIES ELNAREALNV IACEGAERIQ  480
RPETYKQWQA RTVRAGFKQL PLDRNLLGKA KAMVEIDSYS ICFAHV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A3e-461765025328GRAS family transcription factor containing protein, expressed
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in plant development. {ECO:0000250}.
UniProtProbable transcription factor involved in plant development. {ECO:0000250}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_019106559.10.0PREDICTED: scarecrow-like protein 34
SwissprotO809331e-141SCL9_ARATH; Scarecrow-like protein 9
SwissprotQ9XE581e-141SCL14_ARATH; Scarecrow-like protein 14
TrEMBLA0A0K9QAZ30.0A0A0K9QAZ3_SPIOL; Uncharacterized protein (Fragment)
STRINGXP_010685731.10.0(Beta vulgaris)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37650.11e-141GRAS family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]