PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AHYPO_021138-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Amaranthaceae; Amaranthus
Family GRAS
Protein Properties Length: 688aa    MW: 77941.4 Da    PI: 4.7795
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AHYPO_021138-RAgenomeBYUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS363.13.8e-1113146851374
             GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfs 94 
                      l++lL++cA+avss dl+ a++lL+++++++sp+gd++qRla++++++L+arla+++s+    ++  + s   ss+ l+ +++++ + P+ ++ 
  AHYPO_021138-RA 314 LRTLLIQCAQAVSSFDLRTANELLKQIRQHSSPYGDSIQRLAHHVANGLEARLAGTGSTFTTNISDIQIS---SSDFLKGYRVYVSAIPFKRVN 404
                      6789***************************************************888888877777777...9******************** PP

             GRAS  95 hltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrl 186
                      +++aN+aIl+ +e+++++HiiDf++  GlQWp+L+q+L++Rp+gpp+lRiTg++ p++g    e++++tg+rLa ++e++gvpfe++  +a+++
  AHYPO_021138-RA 405 FFLANNAILKLTEKATKIHIIDFGVFLGLQWPCLIQSLSKRPNGPPKLRITGIDLPQPGfrPCERINATGRRLAGYCERFGVPFEYQG-IAEKW 497
                      **********************************************************99999*************************.7**** PP

             GRAS 187 edleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklprese 280
                      e++++eeL+++++E ++Vn++ +  +llde+v+ +s+rd++L+l+++l+P+++++   +   +++ F  rf eal +ys++f+ +ea+lpr+++
  AHYPO_021138-RA 498 ENVQPEELKIESDEIVIVNCMCRSGTLLDETVDANSPRDAFLELIRKLNPTLFIHGIVNGTFTAPFFISRFKEALFHYSSIFEVFEATLPRHAH 591
                      ********************************************************************************************** PP

             GRAS 281 erikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                      er+ +E e+ ++e+ nvvaceg+er++r et+++W+ r  +aG++++pl+ + + qak +++  + + + v+e+++++++gWk+r   ++S+W+
  AHYPO_021138-RA 592 ERKLIESEIYEKELINVVACEGSERIQRPETYKQWQVRSARAGLRQLPLDREFVRQAKVMIKANYHEDFLVDEDRHWMLQGWKGRIFCALSFWQ 685
                      *****************************************************************999*************************6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098563.488288665IPR005202Transcription factor GRAS
PfamPF035141.3E-108314685IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 688 aa     Download sequence    Send to blast
MNSVLVDSDF MNNVFKLNPE MLSNFPKNSP FEEFFQNSDY VDPQILPSDH NEGNISLEEP  60
NLINLDTLSL EQNESNISSE IPDFPDDCLK FISEILLEEN LDENPASAQE FLALQATEKS  120
LYDVIGESYP YPYSDSTQNQ NPESPDATCS NNSFSSLDSN LSFNQPELDP FVSVDDFVQS  180
FLELNPQTYD PNVEDPNDGL VSGGVVNKLP SSDPVKREKS VRGLRRKKSR QRDDVSDEGV  240
RSNKIQAAMS EDYAEMKEYD DVLLSDEHNA DVTYSPNSRC SADEAGGKMS KKGGDRSRKT  300
RGKKQNIKVD EVDLRTLLIQ CAQAVSSFDL RTANELLKQI RQHSSPYGDS IQRLAHHVAN  360
GLEARLAGTG STFTTNISDI QISSSDFLKG YRVYVSAIPF KRVNFFLANN AILKLTEKAT  420
KIHIIDFGVF LGLQWPCLIQ SLSKRPNGPP KLRITGIDLP QPGFRPCERI NATGRRLAGY  480
CERFGVPFEY QGIAEKWENV QPEELKIESD EIVIVNCMCR SGTLLDETVD ANSPRDAFLE  540
LIRKLNPTLF IHGIVNGTFT APFFISRFKE ALFHYSSIFE VFEATLPRHA HERKLIESEI  600
YEKELINVVA CEGSERIQRP ETYKQWQVRS ARAGLRQLPL DREFVRQAKV MIKANYHEDF  660
LVDEDRHWML QGWKGRIFCA LSFWQPS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3g_A4e-502986863380Protein SCARECROW
5b3h_A4e-5032068624379Protein SCARECROW
5b3h_D4e-5032068624379Protein SCARECROW
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021863662.10.0scarecrow-like protein 30
TrEMBLA0A0K9QTP60.0A0A0K9QTP6_SPIOL; Uncharacterized protein
STRINGXP_010685735.10.0(Beta vulgaris)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07530.11e-156SCARECROW-like 14