PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AHYPO_020614-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Amaranthaceae; Amaranthus
Family WOX
Protein Properties Length: 389aa    MW: 44194.9 Da    PI: 8.8918
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AHYPO_020614-RAgenomeBYUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox68.67.9e-2265124357
                      --SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
         Homeobox   3 kRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57 
                      +R+++t+eql++Leel+++ +r+p+ae++++++++l    +++ ++V++WFqN++a+e++
  AHYPO_020614-RA  65 SRWNPTPEQLRALEELYRRgTRTPTAEQIQHITAQLrrygKIEGKNVFYWFQNHKARERQ 124
                      7*****************99**************************************97 PP

2Wus_type_Homeobox1153.7e-3764126365
  Wus_type_Homeobox   3 rtRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65 
                        ++RW+PtpeQ++ Leely++G+rtP++e+iq+ita+L++yGkie+kNVfyWFQN+kaRerqk+
    AHYPO_020614-RA  64 SSRWNPTPEQLRALEELYRRGTRTPTAEQIQHITAQLRRYGKIEGKNVFYWFQNHKARERQKR 126
                        79***********************************************************95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007111.25660125IPR001356Homeobox domain
SMARTSM003897.3E-662129IPR001356Homeobox domain
PfamPF000461.8E-1965124IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.604.7E-965124IPR009057Homeodomain-like
SuperFamilySSF466899.64E-1265130IPR009057Homeodomain-like
CDDcd000861.69E-666126No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0048513Biological Processanimal organ development
GO:0099402Biological Processplant organ development
GO:0005829Cellular Componentcytosol
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 389 aa     Download sequence    Send to blast
MAYNYNEIAV ATQDPFKGAG NRKLRPLVPR PYLSPLPENT PSLTPFNFED NTNKETNTHQ  60
VMVSSRWNPT PEQLRALEEL YRRGTRTPTA EQIQHITAQL RRYGKIEGKN VFYWFQNHKA  120
RERQKRRRQL QLPTTNTAGN RIGYEAEQKS CKWAPSTNKE SDPPIQITEA ESGGVTKADQ  180
TSSTSDAWIQ FHHHNTHHPL PPQFQHNHTI NNNNNNNNNI INIPSPGTNL LFAGERNVTW  240
HHNNLMVQPY SSSCSCCSYP NSNSNSNSPL PSLPFSLSSK FNPSSILSQI HRKPDKPVNN  300
NRDNVIHGGV GSVTPPSSPT LQLFPVLLKS HHHHDHHDNH MEIMITKEDE ERENDASLLL  360
LKNSCNNEKA TSNNNNNVNN PFPYYQFL*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021724753.11e-93WUSCHEL-related homeobox 1-like isoform X1
TrEMBLA0A0K9R3X63e-78A0A0K9R3X6_SPIOL; Uncharacterized protein
STRINGXP_010688870.18e-75(Beta vulgaris)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18010.13e-35WUSCHEL related homeobox 1