PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AHYPO_020372-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Amaranthaceae; Amaranthus
Family WOX
Protein Properties Length: 150aa    MW: 17450.8 Da    PI: 9.4492
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AHYPO_020372-RAgenomeBYUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox47.13.9e-152501457
                     HHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
         Homeobox 14 eLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57
                     +Leel++   r+p+a+++++++++l    +++ ++V++WFqN++a+e++
  AHYPO_020372-RA  2 ILEELYRGgLRTPNASQIQHITSHLslygKIEGKNVFYWFQNHKARERQ 50
                     8******99**************************************97 PP

2Wus_type_Homeobox92.24.7e-301511464
  Wus_type_Homeobox 14 kiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqk 64
                       +iLeely+ GlrtPn+++iq+it++L+ yGkie+kNVfyWFQN+kaRerqk
    AHYPO_020372-RA  1 MILEELYRGGLRTPNASQIQHITSHLSLYGKIEGKNVFYWFQNHKARERQK 51
                       69************************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500719.345151IPR001356Homeobox domain
SuperFamilySSF466893.59E-7251IPR009057Homeodomain-like
PfamPF000469.8E-13250IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.603.6E-4350IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 150 aa     Download sequence    Send to blast
MILEELYRGG LRTPNASQIQ HITSHLSLYG KIEGKNVFYW FQNHKARERQ KLRKKLVAKQ  60
HLQFTFSHDS LPNCNHHHVF DQHFQYLPNY HHFDPTFLPP PPLPPPSSCS RPTTASLGVF  120
HQLPPLTSSP CFAAHHVTNS YTWKMDNTLE
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021856279.15e-41WUSCHEL-related homeobox 3-like
TrEMBLA0A0K9R2641e-39A0A0K9R264_SPIOL; Uncharacterized protein
STRINGXP_010686181.14e-38(Beta vulgaris)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G28610.12e-30WOX family protein