PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AHYPO_019919-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Amaranthaceae; Amaranthus
Family LBD
Protein Properties Length: 195aa    MW: 20444.2 Da    PI: 6.2456
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AHYPO_019919-RAgenomeBYUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260125.91.9e-3911109199
           DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkael 94 
                      +CaaCk++rrkC+++C++apyfp ++p+kfa vhk++Gasn+ kll++l+   reda+ slvyeA+ar+ dPvyG+vg i+ lqq+l+q+++ +
  AHYPO_019919-RA  11 PCAACKLQRRKCTQECIFAPYFPPDDPNKFATVHKVYGASNIAKLLSELNVGAREDAVISLVYEAQARLLDPVYGCVGQIQVLQQRLKQTQTLV 104
                      7*****************************************************************************************9877 PP

           DUF260  95 allke 99 
                       ++k+
  AHYPO_019919-RA 105 IAAKK 109
                      66665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089124.78310111IPR004883Lateral organ boundaries, LOB
PfamPF031953.9E-3911103IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009954Biological Processproximal/distal pattern formation
GO:0009965Biological Processleaf morphogenesis
GO:0048441Biological Processpetal development
Sequence ? help Back to Top
Protein Sequence    Length: 195 aa     Download sequence    Send to blast
KSGMSTSLNS PCAACKLQRR KCTQECIFAP YFPPDDPNKF ATVHKVYGAS NIAKLLSELN  60
VGAREDAVIS LVYEAQARLL DPVYGCVGQI QVLQQRLKQT QTLVIAAKKE LATYVGPYMM  120
MHHQYNLSPI MGIPTGIVTG PCLSQGGAVG PELFEAQLQF NEESLGDGGG GGGGGGGGGD  180
GREGEDSSRS TTTT*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A2e-411011410114LOB family transfactor Ramosa2.1
5ly0_B2e-411011410114LOB family transfactor Ramosa2.1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtControls the proximal-distal patterning in petals and the adaxial-abaxial determination of leaves. Involved in the repression of the homeobox gene BP. {ECO:0000269|PubMed:12787254, ECO:0000269|PubMed:15821980}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010687953.12e-64PREDICTED: LOB domain-containing protein 36
SwissprotQ9FKZ36e-56LBD36_ARATH; LOB domain-containing protein 36
TrEMBLA0A438FB101e-60A0A438FB10_VITVI; LOB domain-containing protein 36
STRINGXP_010687953.18e-64(Beta vulgaris)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66870.18e-58ASYMMETRIC LEAVES 2-like 1
Publications ? help Back to Top
  1. Kim M,Kim MJ,Pandey S,Kim J
    Expression and Protein Interaction Analyses Reveal Combinatorial Interactions of LBD Transcription Factors During Arabidopsis Pollen Development.
    Plant Cell Physiol., 2016. 57(11): p. 2291-2299
    [PMID:27519310]
  2. Wang Z,Wang Y,Kohalmi SE,Amyot L,Hannoufa A
    SQUAMOSA PROMOTER BINDING PROTEIN-LIKE 2 controls floral organ development and plant fertility by activating ASYMMETRIC LEAVES 2 in Arabidopsis thaliana.
    Plant Mol. Biol., 2016. 92(6): p. 661-674
    [PMID:27605094]