PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AHYPO_019010-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Amaranthaceae; Amaranthus
Family LBD
Protein Properties Length: 169aa    MW: 18582.3 Da    PI: 8.1328
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AHYPO_019010-RAgenomeBYUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260144.72.7e-45131121100
           DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkael 94 
                      +CaaCk+lrr+Ca+dCv+apyfpa++p+kfa vh++FGasnv k+l++lp ++r da+ss+vyeA+ar+rdPvyG+vg i++lqqq++ l+++l
  AHYPO_019010-RA  13 PCAACKLLRRRCAPDCVFAPYFPADEPQKFAHVHRVFGASNVNKMLQELPVHQRGDAVSSMVYEANARVRDPVYGCVGAISSLQQQIDVLQTQL 106
                      7********************************************************************************************* PP

           DUF260  95 allkee 100
                      al+++e
  AHYPO_019010-RA 107 ALAQAE 112
                      *99976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.21912113IPR004883Lateral organ boundaries, LOB
PfamPF031953.5E-4513110IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 169 aa     Download sequence    Send to blast
MKENGRKQGA VAPCAACKLL RRRCAPDCVF APYFPADEPQ KFAHVHRVFG ASNVNKMLQE  60
LPVHQRGDAV SSMVYEANAR VRDPVYGCVG AISSLQQQID VLQTQLALAQ AEVVHMRMRQ  120
YANAMPHQGT SSPENSPSSK MISSQTKSLF SMDMVVDQPN IEESLWSC*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A6e-5191147112LOB family transfactor Ramosa2.1
5ly0_B6e-5191147112LOB family transfactor Ramosa2.1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010667079.11e-108PREDICTED: LOB domain-containing protein 4
SwissprotQ9SHE96e-77LBD4_ARATH; LOB domain-containing protein 4
TrEMBLA0A0J8DXN71e-107A0A0J8DXN7_BETVU; Uncharacterized protein
STRINGXP_010667079.11e-107(Beta vulgaris)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G31320.13e-79LOB domain-containing protein 4