PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AHYPO_018950-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Amaranthaceae; Amaranthus
Family GRAS
Protein Properties Length: 532aa    MW: 59044.4 Da    PI: 5.9866
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AHYPO_018950-RAgenomeBYUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS447.11.1e-1361605292374
             GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfsh 95 
                      +++L++cA+av ++d+  aq+l+ +l++++s +g+p+qRl ay++e+L a+ a+s+s++ykal+++e +   s++ l+++++++ev+P++kf++
  AHYPO_018950-RA 160 KQVLVACARAVVENDQLVAQWLMDELRQMVSVAGEPIQRLGAYMLEGLVAKQASSGSSIYKALKSKEPA---SADLLSYMHILFEVCPYIKFGY 250
                      689*****************************************************************9...9********************* PP

             GRAS  96 ltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrle 187
                      + aN aI ea++ e+rvHiiDf+i+qG QW++Llqa+asRp+g+p++RiTg++++ s   +   l+ +g+rL+++A++++vpfef++ v  +  
  AHYPO_018950-RA 251 MSANGAIAEAMKDERRVHIIDFQIGQGSQWVTLLQAFASRPGGAPHIRITGIDDSYSAyaRGGGLNIVGQRLSRLAQAFKVPFEFHA-VDISGC 343
                      ******************************************************877788999************************.566899 PP

             GRAS 188 dleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpresee 281
                      +++l++L v++gEalaVn++++lh+++desvs+e++rd++L+lv++l+Pkvv++veqe+++n++sFl rfle+++yy+a+f+s++++lpr +++
  AHYPO_018950-RA 344 QVQLKDLGVRRGEALAVNFAFMLHHMPDESVSTENHRDRLLRLVRGLNPKVVTLVEQECNTNTASFLPRFLETMDYYMAMFESMDVTLPRVHKD 437
                      9********************************************************************************************* PP

             GRAS 282 rikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                      ri+vE+++l+r++vn+vacegaer+erhe l+kWr+r+++aGFkp+pls  +++++k+ll+++  + yr+ee++g+l+lgW++r Lv+ +aW+
  AHYPO_018950-RA 438 RINVEQHCLARDVVNLVACEGAERVERHELLGKWRSRFTMAGFKPYPLSVLVNSTIKTLLQNYC-NSYRLEERDGALYLGWMNRDLVASCAWQ 529
                      ***************************************************************9.55*************************6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098567.236133510IPR005202Transcription factor GRAS
PfamPF035143.9E-134160529IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009640Biological Processphotomorphogenesis
GO:0005737Cellular Componentcytoplasm
GO:0004871Molecular Functionsignal transducer activity
Sequence ? help Back to Top
Protein Sequence    Length: 532 aa     Download sequence    Send to blast
MSNSLYYQAK REIDAYFMPQ CQPLNPQLCY SNLSNGSYAI SKVSPGQYST LESSSGIGSY  60
LMHSSTSTLS FASSESPGSL LDSSSYPDNA NNSPVSNSCV TEDMGDLKCK LRELESVMLG  120
PDSDIIDGYC NMIESGSLVT PLEMDSWGKV IDMIARKDVK QVLVACARAV VENDQLVAQW  180
LMDELRQMVS VAGEPIQRLG AYMLEGLVAK QASSGSSIYK ALKSKEPASA DLLSYMHILF  240
EVCPYIKFGY MSANGAIAEA MKDERRVHII DFQIGQGSQW VTLLQAFASR PGGAPHIRIT  300
GIDDSYSAYA RGGGLNIVGQ RLSRLAQAFK VPFEFHAVDI SGCQVQLKDL GVRRGEALAV  360
NFAFMLHHMP DESVSTENHR DRLLRLVRGL NPKVVTLVEQ ECNTNTASFL PRFLETMDYY  420
MAMFESMDVT LPRVHKDRIN VEQHCLARDV VNLVACEGAE RVERHELLGK WRSRFTMAGF  480
KPYPLSVLVN STIKTLLQNY CNSYRLEERD GALYLGWMNR DLVASCAWQC S*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A4e-591595294375GRAS family transcription factor containing protein, expressed
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in phytochrome A (phyA) signal transduction. {ECO:0000269|PubMed:10817761}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021724509.10.0scarecrow-like protein 21 isoform X1
RefseqXP_021724510.10.0scarecrow-like protein 21 isoform X1
RefseqXP_021724511.10.0scarecrow-like protein 21 isoform X1
SwissprotQ9LDL70.0PAT1_ARATH; Scarecrow-like transcription factor PAT1
TrEMBLA0A0J8B9350.0A0A0J8B935_BETVU; Uncharacterized protein
STRINGXP_010666093.10.0(Beta vulgaris)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G48150.20.0GRAS family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  3. Heyman J, et al.
    The heterodimeric transcription factor complex ERF115-PAT1 grants regeneration competence.
    Nat Plants, 2016. 2(11): p. 16165
    [PMID:27797356]