PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AHYPO_018210-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Amaranthaceae; Amaranthus
Family LBD
Protein Properties Length: 255aa    MW: 28210.4 Da    PI: 7.4046
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AHYPO_018210-RAgenomeBYUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260133.67.6e-42471461100
           DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkael 94 
                      +CaaCk+lrr+Ca++C+++pyf  ++p+kfa vhk+FGasnv+k+l ++pe++r da++slvyeA++r+rdP+yG++g i++lqqq++ l+ael
  AHYPO_018210-RA  47 PCAACKLLRRRCAQECPFSPYFSPHEPQKFASVHKVFGASNVSKMLMEVPENQRADAANSLVYEANVRLRDPIYGCMGAISALQQQIQLLQAEL 140
                      7********************************************************************************************* PP

           DUF260  95 allkee 100
                      +++++e
  AHYPO_018210-RA 141 NAVRAE 146
                      **9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.81346147IPR004883Lateral organ boundaries, LOB
PfamPF031957.5E-4247144IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
Sequence ? help Back to Top
Protein Sequence    Length: 255 aa     Download sequence    Send to blast
MSRERERFDE IGKKIKRDQN DAFSKTGGGG RRHIQLDPPG TLNTITPCAA CKLLRRRCAQ  60
ECPFSPYFSP HEPQKFASVH KVFGASNVSK MLMEVPENQR ADAANSLVYE ANVRLRDPIY  120
GCMGAISALQ QQIQLLQAEL NAVRAEILKY KFNDPNNHVS NIITTNNNPS SSSHNHLTFF  180
SSATSVSIAA PPPPPSPPPL SPPLHDLDHH PSINPTISSS MYTPTQPSSS RNDHDDHNHD  240
HYSSISNENI SYFD*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A6e-45391543118LOB family transfactor Ramosa2.1
5ly0_B6e-45391543118LOB family transfactor Ramosa2.1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818212e-46LN681821.1 Cucumis melo genomic scaffold, anchoredscaffold00040.
GenBankLN7132572e-46LN713257.1 Cucumis melo genomic chromosome, chr_3.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021732598.11e-103LOB domain-containing protein 15-like
SwissprotQ8L5T52e-80LBD15_ARATH; LOB domain-containing protein 15
TrEMBLA0A2P5AHJ81e-96A0A2P5AHJ8_TREOI; Wilm's tumor protein
STRINGXP_010695789.11e-101(Beta vulgaris)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40470.12e-78LOB domain-containing protein 15
Publications ? help Back to Top
  1. Ohashi-Ito K,Iwamoto K,Fukuda H
    LOB DOMAIN-CONTAINING PROTEIN 15 Positively Regulates Expression of VND7, a Master Regulator of Tracheary Elements.
    Plant Cell Physiol., 2018. 59(5): p. 989-996
    [PMID:29444288]