PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AHYPO_017684-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Amaranthaceae; Amaranthus
Family WOX
Protein Properties Length: 162aa    MW: 18379.8 Da    PI: 9.8454
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AHYPO_017684-RAgenomeBYUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox65.19.9e-21666257
                     T--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
         Homeobox  2 rkRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57
                     ++R+++t+eq+ +Lee+++   r+p+a+++++++++l    +++ ++V++WFqN++a++++
  AHYPO_017684-RA  6 STRWCPTPEQVMILEEMYRGgVRTPNAAQIQQITAHLshygKIEGKNVFYWFQNHKARDRQ 66
                     58*****************99*************************************996 PP

2Wus_type_Homeobox122.81.4e-39567264
  Wus_type_Homeobox  2 artRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqk 64
                       a+tRW+PtpeQ++iLee+y+ G+rtPn+++iq+ita+L++yGkie+kNVfyWFQN+kaR+rqk
    AHYPO_017684-RA  5 ASTRWCPTPEQVMILEEMYRGGVRTPNAAQIQQITAHLSHYGKIEGKNVFYWFQNHKARDRQK 67
                       689***********************************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500719.863267IPR001356Homeobox domain
SMARTSM003895.2E-5471IPR001356Homeobox domain
PfamPF000462.2E-18766IPR001356Homeobox domain
CDDcd000867.69E-5767No hitNo description
SuperFamilySSF466891.45E-11767IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.6E-7866IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008283Biological Processcell proliferation
GO:0009908Biological Processflower development
GO:0009943Biological Processadaxial/abaxial axis specification
GO:0009947Biological Processcentrolateral axis specification
GO:0010865Biological Processstipule development
GO:0048513Biological Processanimal organ development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 162 aa     Download sequence    Send to blast
MSPAASTRWC PTPEQVMILE EMYRGGVRTP NAAQIQQITA HLSHYGKIEG KNVFYWFQNH  60
KARDRQKLRK KLLGKQFQHQ QIFFSHNTFP YHPFDQLPLS HHNLHFDLPP PPPPXLVISE  120
HVPNLVTQPG TCADTIFIIV VPATTATTSS TTLFRSHAVF P*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021716042.12e-50WUSCHEL-related homeobox 3-like
TrEMBLA0A0K9R2642e-48A0A0K9R264_SPIOL; Uncharacterized protein
STRINGcassava4.1_030827m3e-48(Manihot esculenta)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G28610.11e-35WOX family protein