PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AHYPO_017426-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Amaranthaceae; Amaranthus
Family CAMTA
Protein Properties Length: 992aa    MW: 111416 Da    PI: 6.0734
Description CAMTA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AHYPO_017426-RAgenomeBYUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CG-1181.21.2e-56221364118
             CG-1   4 ekkrwlkneeiaaiLenfekheltlelktrpksgsliLynrkkvryfrkDGyswkkkkdgktvrEdhekLKvggvevlycyYahseenptfqrr 97 
                       ++rwl++ ei++iL n++k+++++e++++p+sgsl+L++rk++ryfrkDG++w+kkkdgkt++E+hekLKv++v++l+cyYah+++n+ fqrr
  AHYPO_017426-RA  22 ARHRWLRAAEICEILRNHQKFQISSEPPNQPSSGSLFLFDRKVLRYFRKDGHNWRKKKDGKTIKEAHEKLKVDSVDMLHCYYAHGDDNECFQRR 115
                      59******************************************************************************************** PP

             CG-1  98 cywlLeeelekivlvhylevk 118
                      +ywlLeee+ +iv+vhylevk
  AHYPO_017426-RA 116 SYWLLEEEFMHIVFVHYLEVK 136
                      ******************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5143779.70115141IPR005559CG-1 DNA-binding domain
SMARTSM010762.7E-7718136IPR005559CG-1 DNA-binding domain
PfamPF038599.8E-5022135IPR005559CG-1 DNA-binding domain
Gene3DG3DSA:2.60.40.105.4E-7391508IPR013783Immunoglobulin-like fold
PfamPF018331.3E-5421506IPR002909IPT domain
SuperFamilySSF812966.38E-16421506IPR014756Immunoglobulin E-set
Gene3DG3DSA:1.25.40.201.0E-14579722IPR020683Ankyrin repeat-containing domain
PROSITE profilePS5029713.443591706IPR020683Ankyrin repeat-containing domain
SuperFamilySSF484033.22E-14592699IPR020683Ankyrin repeat-containing domain
CDDcd002044.19E-7623694No hitNo description
SuperFamilySSF525402.42E-8811864IPR027417P-loop containing nucleoside triphosphate hydrolase
SMARTSM000150.016813835IPR000048IQ motif, EF-hand binding site
PROSITE profilePS500968.553814843IPR000048IQ motif, EF-hand binding site
PfamPF006122.7E-4815834IPR000048IQ motif, EF-hand binding site
SMARTSM000150.006836858IPR000048IQ motif, EF-hand binding site
PROSITE profilePS500969.523837861IPR000048IQ motif, EF-hand binding site
PfamPF006123.6E-4840858IPR000048IQ motif, EF-hand binding site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009409Biological Processresponse to cold
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0071275Biological Processcellular response to aluminum ion
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 992 aa     Download sequence    Send to blast
MANGGFINPG IRLDIQQLQL DARHRWLRAA EICEILRNHQ KFQISSEPPN QPSSGSLFLF  60
DRKVLRYFRK DGHNWRKKKD GKTIKEAHEK LKVDSVDMLH CYYAHGDDNE CFQRRSYWLL  120
EEEFMHIVFV HYLEVKGNRN SSRETEPVIS TSQISNSMSS SVSNSYNDAF TGNAGSPSAA  180
SSLNSYDEIE SEDNHQAISR YPSPSFSHVE ARFENNKMGA IINSTFLPSY QEEYKGPQPL  240
DYVSLVQQGV GTKDDNQFKT LDLASWEEVF QQSTRSSENL QANPLVSAAP LVGSTDVFNE  300
NFSLFLDAGF GVDSMEGGSL ASYLPNYNPL STEFPDNTNV SVIAKHPLLG NILMGEGLQK  360
VDSFSKWMSK EFSGVDDLYL NSSLDYSWQN IETSTSVDDP SIQHENYTVS PSIGYDQLFD  420
IQDFSPSCSS NDTETKVVIT GKFLVDPAEV FKYNWSCMFG EVEVPAEVLG NGILCCYAPL  480
HTAGRVPFYV TCSNRFACSQ VREFEYLLDS QRAINRSVSG DSIMEQQLWH RLQKLLSLKN  540
PANLDPVTKS FRKNEPIFSK ILLLMEDELC LGVEQQLKEK VVSWLFDKVS EDGKGPNVLD  600
ELGQGLLHLA AALGLDWIIP PTVATGVSVN FRDVCGWTAL HWAAFYGRET TVALLVALEA  660
ASGAVTDPSP EFPLGRTAAD LASANGFKGI SGFLAEHSLT AHLETLTMAD RKLDTPLDDS  720
MNKAVHTMRE NVATPGIEGD GSDLPLKDSL AAVRNATQAA GRIHQVFRMQ SFQRKHVSKG  780
AGPFGNYESL LSDEQLLLLV SSKIQRPGHP DEQTHSAAIR IQKKYRGYKK RKEFLIIRER  840
VVRIQAHVRG HQVRKRYKTV VWSVGILEKV ILRWRRRGTG LRGFRPDALY KASSTLGTQD  900
VQKISSEDDD YDFLKDGRKQ TEERLQKALV RVKSMVQYPD GRAQYRRILT AVEGFQKNQV  960
HENTRKNSED VPVEGEEDKI YVESLLDVTF E*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00043PBMTransfer from AT5G64220Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010690491.10.0PREDICTED: calmodulin-binding transcription activator 2 isoform X1
RefseqXP_010690492.10.0PREDICTED: calmodulin-binding transcription activator 2 isoform X2
SwissprotQ6NPP40.0CMTA2_ARATH; Calmodulin-binding transcription activator 2
TrEMBLA0A0J8BJ800.0A0A0J8BJ80_BETVU; Uncharacterized protein
TrEMBLA0A0J8EEU30.0A0A0J8EEU3_BETVU; Uncharacterized protein
STRINGscaffold_803130.10.0(Arabidopsis lyrata)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G09410.30.0ethylene induced calmodulin binding protein