PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AHYPO_017031-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Amaranthaceae; Amaranthus
Family WOX
Protein Properties Length: 283aa    MW: 31371 Da    PI: 5.0159
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AHYPO_017031-RAgenomeBYUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox67.22.2e-21100160257
                      T--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
         Homeobox   2 rkRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57 
                      r+R+t+t+ ql++Le+ F + + +ps+++++e++++l    +++e++V++WFqNrRa+ k+
  AHYPO_017031-RA 100 RQRWTPTPVQLQILERIFDQgTGTPSKQKIKEITAELsqhgQISETNVYNWFQNRRARSKR 160
                      89*****************99**************************************97 PP

2Wus_type_Homeobox1049.9e-3499162265
  Wus_type_Homeobox   2 artRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65 
                        ar+RWtPtp Q++iLe+++++G+ tP+k++i++itaeL+++G+i+++NV++WFQNr+aR+++kq
    AHYPO_017031-RA  99 ARQRWTPTPVQLQILERIFDQGTGTPSKQKIKEITAELSQHGQISETNVYNWFQNRRARSKRKQ 162
                        789***********************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007114.75496161IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.602.9E-1797165IPR009057Homeodomain-like
SMARTSM003891.1E-1498165IPR001356Homeobox domain
SuperFamilySSF466896.42E-1899162IPR009057Homeodomain-like
CDDcd000861.54E-14100162No hitNo description
PfamPF000463.2E-19100160IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 283 aa     Download sequence    Send to blast
MMEPQQIPQS LQQPHENGNG IGLIDGTNNG GINGVLYVKV MTDEQLEILR TQIAVYATIC  60
EQLVEMHKAI TAQQDLAGVR LGNLYCDPLV SAVGHKITAR QRWTPTPVQL QILERIFDQG  120
TGTPSKQKIK EITAELSQHG QISETNVYNW FQNRRARSKR KQLNNTQNNG ESEVETDAES  180
PKDKKTKPEI FQSQPNSILR ADDSCFQNQE LSSSMHTIDS QPGKIDPVFA SDGSSKSTQS  240
LSQLAFYESI LQNPRIDDLI GKMEVPGSYS GYPPTEDYSM TG*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1153161RRARSKRKQ
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor which may be involved in developmental processes. {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00669PBMTransfer from GRMZM2G038252Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010680605.11e-171PREDICTED: WUSCHEL-related homeobox 8
SwissprotQ5QMM31e-92WOX8_ORYSJ; WUSCHEL-related homeobox 8
TrEMBLA0A0K9QH841e-161A0A0K9QH84_SPIOL; Uncharacterized protein
STRINGXP_010680605.11e-171(Beta vulgaris)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35550.16e-89WUSCHEL related homeobox 13
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]