PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AHYPO_016222-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Amaranthaceae; Amaranthus
Family GRAS
Protein Properties Length: 583aa    MW: 65173.5 Da    PI: 6.5616
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AHYPO_016222-RAgenomeBYUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS426.12.8e-1302125811373
             GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfs 94 
                      l++lL+ecA+a+s++ +   ++l+++ ++ +s +g+p+qRl ay+ e+L ar  +s++++y+al+++e      +e l+++++++e++P+lkf+
  AHYPO_016222-RA 212 LKKLLIECARALSENRFDDFERLVEQARKEVSISGEPIQRLGAYMIEGLVARKESSGNNIYRALKCKEPL---GKELLSYMHILYEICPYLKFG 302
                      5799*****************************************************************8...9******************** PP

             GRAS  95 hltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrl 186
                      +++aN aI ea  +e+r+HiiDf+i qG+QW++LlqaLa+Rp+g+p +RiTg+++p s+  +  +le++g+rLa + e+ ++p+ef++ v   l
  AHYPO_016222-RA 303 YMAANGAIAEACRNEDRIHIIDFQIAQGTQWLTLLQALATRPGGAPYVRITGIDDPVSQyaRGASLEAVGKRLAALSEKHNIPVEFHA-VPVFL 395
                      ********************************************************9999999*************************.7999* PP

             GRAS 187 edleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklprese 280
                       d++ e+L+v+pgEa+aVn+ lqlh+++desv+++++rd +L++vksl+Pkv +++eqe+++n+++Fl+rf+eal+yysa+f+s+++++pr+ +
  AHYPO_016222-RA 396 PDVTKEMLDVRPGEAVAVNFPLQLHHTPDESVDVNNPRDGLLRMVKSLRPKVTTLIEQESNTNTTPFLTRFIEALSYYSAMFESIDVTMPRDRK 489
                      ********************************************************************************************** PP

             GRAS 281 erikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaW 373
                      eri+vE+++l+++ivnv+aceg er+erhe l+kW++r+++aGF+++pls+++++ ++ llr ++ + y++ e++g ++lgWkdr Lvs+SaW
  AHYPO_016222-RA 490 ERISVEQHCLAKDIVNVIACEGLERVERHELLGKWKSRFTMAGFQQYPLSSYVNSVIRELLRCYS-EHYTLVEKDGGMLLGWKDRMLVSASAW 581
                      *************************************************************9999.66************************* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098565.501186563IPR005202Transcription factor GRAS
PfamPF035149.7E-128212581IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 583 aa     Download sequence    Send to blast
MDSHKIFGYN VIGADSSYMS SQYSSPQVPS RLFGSLKFNF KDSPISPFSS PFECDTATTL  60
SDSREHHSSS ESLSGKSPSC NSPLETNSYY QRLNSSPSED SQSSTVLPTT RGILFPQNSD  120
HETNMRYALQ ELETVLMGDE SVGGGSRQHH FPSERLASWN RSSQGSHGAQ LQSPSPSGER  180
ISDDNGGRQS EKRRKAAMKE EIPELKSPSG DLKKLLIECA RALSENRFDD FERLVEQARK  240
EVSISGEPIQ RLGAYMIEGL VARKESSGNN IYRALKCKEP LGKELLSYMH ILYEICPYLK  300
FGYMAANGAI AEACRNEDRI HIIDFQIAQG TQWLTLLQAL ATRPGGAPYV RITGIDDPVS  360
QYARGASLEA VGKRLAALSE KHNIPVEFHA VPVFLPDVTK EMLDVRPGEA VAVNFPLQLH  420
HTPDESVDVN NPRDGLLRMV KSLRPKVTTL IEQESNTNTT PFLTRFIEAL SYYSAMFESI  480
DVTMPRDRKE RISVEQHCLA KDIVNVIACE GLERVERHEL LGKWKSRFTM AGFQQYPLSS  540
YVNSVIRELL RCYSEHYTLV EKDGGMLLGW KDRMLVSASA WH*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3g_A3e-6121858125378Protein SCARECROW
5b3h_A3e-6121858124377Protein SCARECROW
5b3h_D3e-6121858124377Protein SCARECROW
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtMay play a regulatory role in the early step of oligosaccharide elicitor response, downstream of the membrane-associated high-affinity chitin-binding protein. {ECO:0000269|PubMed:12591613}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By oligosaccharide elicitor (N-Acetylchitooligosaccharide) extracted from the rice blast fungus (M.grisea) cell wall. Strongest induction by chitin oligomer with greater degree of polymerization (heptamer). By inoculation of M.grisea in rice cell suspension culture. {ECO:0000269|PubMed:12591613}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010694285.10.0PREDICTED: scarecrow-like protein 21
RefseqXP_019108087.10.0PREDICTED: scarecrow-like protein 21
SwissprotQ69VG10.0CIGR1_ORYSJ; Chitin-inducible gibberellin-responsive protein 1
TrEMBLA0A0K9RKI50.0A0A0K9RKI5_SPIOL; Uncharacterized protein
STRINGXP_010694285.10.0(Beta vulgaris)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G50600.11e-163scarecrow-like 5
Publications ? help Back to Top
  1. Day RB, et al.
    Two rice GRAS family genes responsive to N -acetylchitooligosaccharide elicitor are induced by phytoactive gibberellins: evidence for cross-talk between elicitor and gibberellin signaling in rice cells.
    Plant Mol. Biol., 2004. 54(2): p. 261-72
    [PMID:15159627]