PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AHYPO_015956-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Amaranthaceae; Amaranthus
Family WOX
Protein Properties Length: 477aa    MW: 51263.1 Da    PI: 7.189
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AHYPO_015956-RAgenomeBYUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox55.31.1e-1772132257
                      T--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
         Homeobox   2 rkRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57 
                      ++R+++++eq+++Le+ F++   +p ++e++++ ++l    ++ +++V++WFqNr+ + k+
  AHYPO_015956-RA  72 KPRWNPKPEQIRILEAIFNSgMVNPPRDEIRRIRAQLleygQVGDANVFYWFQNRKSRSKH 132
                      89*****************99*************************************995 PP

2Wus_type_Homeobox110.68.6e-3671134265
  Wus_type_Homeobox   2 artRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65 
                        +++RW+P+peQi+iLe++++sG+++P+++ei+ri+a+L eyG+++d+NVfyWFQNrk+R+++kq
    AHYPO_015956-RA  71 PKPRWNPKPEQIRILEAIFNSGMVNPPRDEIRRIRAQLLEYGQVGDANVFYWFQNRKSRSKHKQ 134
                        689***********************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007110.49568133IPR001356Homeobox domain
SuperFamilySSF466891.41E-1168138IPR009057Homeodomain-like
SMARTSM003895.9E-870137IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.603.7E-771138IPR009057Homeodomain-like
CDDcd000868.25E-971134No hitNo description
PfamPF000462.5E-1572132IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008284Biological Processpositive regulation of cell proliferation
GO:0009735Biological Processresponse to cytokinin
GO:0009793Biological Processembryo development ending in seed dormancy
GO:0010075Biological Processregulation of meristem growth
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 477 aa     Download sequence    Send to blast
MASSNRHWPS MFKSKPCNNQ QWSQHDQDTS HHPSSSLILA SNNTSNTTCA RSSSITAFPF  60
SSGCEERSPE PKPRWNPKPE QIRILEAIFN SGMVNPPRDE IRRIRAQLLE YGQVGDANVF  120
YWFQNRKSRS KHKQRTLQAK MNATALSGNR SGTQNSPSLP ASSSSSSSDK ASPQKAGATL  180
SGSAGGAGSS SYGSGSSGNN YNTSSGNVVV DQFGNSPTSV NQPSPYFHPL VPHPPHHNHV  240
PNTNTTSTTT TTCIQDQTLF FPLHQNGATV MGNFSQQQQQ GLCFGTTNTH DHHYEDHHPH  300
PHPHPLHQIN LDVPHHSDQT VGGFSSLLLG DDEVEKLKFQ HQLSLLVTNP STASTNSPSH  360
AYAFPNSVAQ ILGAGVGDTV APKSTVYING MAVEIPGGHL NVKEFGDTAL LVNTETGEAV  420
PTNEWGVTLH PLHHSASYYL FNGSSGSGSG PAAASLLLHH KHDDNDAVAP GFPYQI*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010686368.11e-134PREDICTED: WUSCHEL-related homeobox 9 isoform X2
TrEMBLA0A0K9R8K31e-127A0A0K9R8K3_SPIOL; Uncharacterized protein (Fragment)
STRINGXP_010686367.11e-133(Beta vulgaris)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G33880.14e-57homeobox-3