PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AHYPO_015224-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Amaranthaceae; Amaranthus
Family GRAS
Protein Properties Length: 481aa    MW: 53612 Da    PI: 5.6214
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AHYPO_015224-RAgenomeBYUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS424.58.7e-1301104801374
             GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfs 94 
                      l+e+L++cA+a+s++d+  a +l+++l++++s +g+p+qRl ay++e+L arl++s+ ++y+al+++e +   s e l++++l++ev+P++kf+
  AHYPO_015224-RA 110 LKEALIACAKAISNDDFLTAAWLISELQNMVSVSGEPIQRLSAYMLEGLIARLSSSGISIYRALKCNEPT---SGELLSYMQLLYEVCPYFKFG 200
                      5789*****************************************************************9...9******************** PP

             GRAS  95 hltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrl 186
                      ++ aN aI +a+++e+++HiiDf+i qG QW++L+qaLa+Rp+gpp++RiTg+++ +s   +   l+ ++erL+++A+++++pf+f++ ++ ++
  AHYPO_015224-RA 201 YMSANGAIADALKNEDKIHIIDFQIAQGSQWVSLIQALAARPGGPPQVRITGLDDTTSAfaRGGGLNIVRERLSNLAKACNLPFQFHA-ATLTF 293
                      *******************************************************98889999*************************.78899 PP

             GRAS 187 edleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklprese 280
                       +  +++L+++p+EalaVn+ + lh+++desv  e++rd++L+lvks sPkvv+++e ++++n+++F  rfle+l++ysa+f+s++++lp+e++
  AHYPO_015224-RA 294 GAEVIQNLELRPDEALAVNFPFLLHHIPDESVGPENHRDSLLRLVKSWSPKVVTLIEYDLNTNTSPFYPRFLETLSFYSAIFESINVTLPKEHR 387
                      9999****************************************************************************************** PP

             GRAS 281 erikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                      eri+vE+++l+reivn++acegaer+erhe  +kWr+r+ +aGF p pls+ +++++++ll+k++   y +ee++g+l+lgW++r Lv+ +aWr
  AHYPO_015224-RA 388 ERINVEQHCLAREIVNIIACEGAERVERHELHGKWRSRFLMAGFMPHPLSSLVNATIRTLLQKYSTS-YGLEERDGALYLGWMNRVLVTSCAWR 480
                      *****************************************************************55.*************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098566.01384461IPR005202Transcription factor GRAS
PfamPF035143.0E-127110480IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 481 aa     Download sequence    Send to blast
MQNSKKLKGI YCTFESSFLT GADNLYRSPS TGSLSGNGSS AVSVLDPESS IDSQEIVNLS  60
PANDLYSTHD TDNLRCRLRE LETAMMEPMS HTSDTENWQQ LVEMISRGEL KEALIACAKA  120
ISNDDFLTAA WLISELQNMV SVSGEPIQRL SAYMLEGLIA RLSSSGISIY RALKCNEPTS  180
GELLSYMQLL YEVCPYFKFG YMSANGAIAD ALKNEDKIHI IDFQIAQGSQ WVSLIQALAA  240
RPGGPPQVRI TGLDDTTSAF ARGGGLNIVR ERLSNLAKAC NLPFQFHAAT LTFGAEVIQN  300
LELRPDEALA VNFPFLLHHI PDESVGPENH RDSLLRLVKS WSPKVVTLIE YDLNTNTSPF  360
YPRFLETLSF YSAIFESINV TLPKEHRERI NVEQHCLARE IVNIIACEGA ERVERHELHG  420
KWRSRFLMAG FMPHPLSSLV NATIRTLLQK YSTSYGLEER DGALYLGWMN RVLVTSCAWR  480
*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3g_A1e-6011747926378Protein SCARECROW
5b3h_A9e-6111747925377Protein SCARECROW
5b3h_D9e-6111747925377Protein SCARECROW
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in phytochrome A (phyA) signal transduction. {ECO:0000269|PubMed:10817761}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010675879.10.0PREDICTED: scarecrow-like protein 21
RefseqXP_010675880.10.0PREDICTED: scarecrow-like protein 21
SwissprotQ9LDL70.0PAT1_ARATH; Scarecrow-like transcription factor PAT1
TrEMBLA0A0K9RZE70.0A0A0K9RZE7_SPIOL; Uncharacterized protein
STRINGXP_010675879.10.0(Beta vulgaris)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G48150.20.0GRAS family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  3. Heyman J, et al.
    The heterodimeric transcription factor complex ERF115-PAT1 grants regeneration competence.
    Nat Plants, 2016. 2(11): p. 16165
    [PMID:27797356]