PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AHYPO_015015-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Amaranthaceae; Amaranthus
Family GRAS
Protein Properties Length: 472aa    MW: 52767.2 Da    PI: 5.0251
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AHYPO_015015-RAgenomeBYUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS418.46e-1281014711374
             GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfs 94 
                      l+e+L++cA+a+s++d+  a++l+ +l++++s +g+p+qRl ay++e+L arl++++ ++y+al+++e +   s e l++++l++ev+P++kf+
  AHYPO_015015-RA 101 LKEALIACAKAISNDDFLTAEWLIYELQNMVSVSGEPIQRLGAYMLEGLVARLSSTGISIYNALKCNEPT---SGELLSYMQLLYEVCPYFKFG 191
                      5789*****************************************************************9...9******************** PP

             GRAS  95 hltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrl 186
                      ++ aN aI +a+++e+++HiiDf+i qG QW++L+qaLa+Rp+gpp++RiTg+++ +s+  +   l  ++erL+++A ++++pfef++ +  ++
  AHYPO_015015-RA 192 YMSANGAIADALKNEDKIHIIDFQIAQGSQWVSLIQALAARPGGPPQVRITGLDDTTSEfaRGGGLDIVRERLSNLAIACNLPFEFHA-AKLTF 284
                      *******************************************************99889999*************************.78899 PP

             GRAS 187 edleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklprese 280
                          +++L+++p+E+laVn+ + lh+++desv  e++rd++L+l+ks sPkvv++ve ++++n+++F  rfle+l++ysa+f+s++++lp++++
  AHYPO_015015-RA 285 GPEVIRNLELRPDEVLAVNFPFLLHHIPDESVGPENHRDSLLRLIKSWSPKVVTLVEYDLNTNTSPFYPRFLETLSFYSAIFESINVTLPKDHK 378
                      9999****************************************************************************************** PP

             GRAS 281 erikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                      +ri+vE+++l+reivn++aceg er+erhe  +kWr+r+ +aGF+p+pls  +++++k+ll+k++   y +ee++g+l+lgW+dr Lv+ +aW+
  AHYPO_015015-RA 379 DRINVEQHCLAREIVNIIACEGGERVERHELHGKWRSRFLMAGFRPYPLSPLVNATIKTLLQKYSTS-YGLEEKDGALYLGWMDRVLVTSCAWQ 471
                      *****************************************************************55.*************************6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098565.35675452IPR005202Transcription factor GRAS
PfamPF035142.1E-125101471IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 472 aa     Download sequence    Send to blast
MQNPENLQGI YCTFESSFIT GVDNLCRSPL TGSIYGNGCS AVSLLDAKST SSDSQEIVIH  60
NIDNLRYQLK ELETVMMEPT SHNSENENWQ KLVGVISRGE LKEALIACAK AISNDDFLTA  120
EWLIYELQNM VSVSGEPIQR LGAYMLEGLV ARLSSTGISI YNALKCNEPT SGELLSYMQL  180
LYEVCPYFKF GYMSANGAIA DALKNEDKIH IIDFQIAQGS QWVSLIQALA ARPGGPPQVR  240
ITGLDDTTSE FARGGGLDIV RERLSNLAIA CNLPFEFHAA KLTFGPEVIR NLELRPDEVL  300
AVNFPFLLHH IPDESVGPEN HRDSLLRLIK SWSPKVVTLV EYDLNTNTSP FYPRFLETLS  360
FYSAIFESIN VTLPKDHKDR INVEQHCLAR EIVNIIACEG GERVERHELH GKWRSRFLMA  420
GFRPYPLSPL VNATIKTLLQ KYSTSYGLEE KDGALYLGWM DRVLVTSCAW Q*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3g_A4e-6010847026378Protein SCARECROW
5b3h_A3e-6010847025377Protein SCARECROW
5b3h_D3e-6010847025377Protein SCARECROW
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in phytochrome A (phyA) signal transduction. {ECO:0000269|PubMed:10817761}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010675879.10.0PREDICTED: scarecrow-like protein 21
RefseqXP_010675880.10.0PREDICTED: scarecrow-like protein 21
SwissprotQ9LDL70.0PAT1_ARATH; Scarecrow-like transcription factor PAT1
TrEMBLA0A0K9RZE70.0A0A0K9RZE7_SPIOL; Uncharacterized protein
STRINGXP_010675879.10.0(Beta vulgaris)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G48150.20.0GRAS family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  3. Heyman J, et al.
    The heterodimeric transcription factor complex ERF115-PAT1 grants regeneration competence.
    Nat Plants, 2016. 2(11): p. 16165
    [PMID:27797356]