PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AHYPO_014999-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Amaranthaceae; Amaranthus
Family NF-YB
Protein Properties Length: 181aa    MW: 18992.9 Da    PI: 6.794
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AHYPO_014999-RAgenomeBYUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB1862.8e-5829124297
            NF-YB   2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyreleg 95 
                      reqdrflPianvsrimkk+lPanakiskdaketvqecvsefisf+t+easdkcqrekrktingddllwa++tlGfe+yv+plkvyl+++releg
  AHYPO_014999-RA  29 REQDRFLPIANVSRIMKKALPANAKISKDAKETVQECVSEFISFITGEASDKCQREKRKTINGDDLLWAMTTLGFEEYVDPLKVYLHRFRELEG 122
                      89******************************************************************************************** PP

            NF-YB  96 ek 97 
                      ek
  AHYPO_014999-RA 123 EK 124
                      97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.102.6E-5326128IPR009072Histone-fold
SuperFamilySSF471131.55E-4031136IPR009072Histone-fold
PfamPF008084.7E-283498IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006151.3E-196280No hitNo description
PROSITE patternPS0068506581IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006151.3E-198199No hitNo description
PRINTSPR006151.3E-19100118No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 181 aa     Download sequence    Send to blast
MADSDNDSGG KSNDHGFHHG NSLTSSSPRE QDRFLPIANV SRIMKKALPA NAKISKDAKE  60
TVQECVSEFI SFITGEASDK CQREKRKTIN GDDLLWAMTT LGFEEYVDPL KVYLHRFREL  120
EGEKTGTGMP VQGNNSGGGG SSNNNGGNGG GVFGIGHVIG QGGHVYGYGG GSGSGVNRGI  180
*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5g49_A4e-4929119797NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT B-6
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtComponent of the NF-Y/HAP transcription factor complex. {ECO:0000250}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010675924.19e-79PREDICTED: nuclear transcription factor Y subunit B-3
RefseqXP_021669737.17e-79nuclear transcription factor Y subunit B-2-like
SwissprotQ75IZ73e-72NFYB8_ORYSJ; Nuclear transcription factor Y subunit B-8
TrEMBLA0A2C9UDJ72e-76A0A2C9UDJ7_MANES; Uncharacterized protein
STRINGXP_010675924.14e-78(Beta vulgaris)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G47640.12e-68nuclear factor Y, subunit B2
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]
  2. Kim SK, et al.
    OsNF-YC2 and OsNF-YC4 proteins inhibit flowering under long-day conditions in rice.
    Planta, 2016. 243(3): p. 563-76
    [PMID:26542958]