PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AHYPO_014426-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Amaranthaceae; Amaranthus
Family GRAS
Protein Properties Length: 471aa    MW: 51820.5 Da    PI: 5.3683
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AHYPO_014426-RAgenomeBYUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS395.36.7e-121984551374
             GRAS   1 lvelLlecAeavssgdlelaqalLarlsel...aspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPil 91 
                      lv++Ll+cAe +++g+l+la++l+ ++ +    + ++ + + ++a yf  AL++rl+       ++l+++ +       +   +++f+e++P+l
  AHYPO_014426-RA  98 LVHALLTCAESIQHGELQLASSLVGEITNElltRVNTSSGIGKVACYFIDALSQRLYP------SSLASQGSL-----PNDVLYHYFYEACPYL 180
                      689**********************998765656667789*****************9......444444443.....33346789******** PP

             GRAS  92 kfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg.skeeleetgerLakfAeelgvpfefnvlvak 184
                      kf+h+taNqaIle++eg++ vH+iDf++++GlQWpaL+qaLa Rp+gppslR+T+v+ p+ + + ++ +etg rL+++A++++v+f+f+v++  
  AHYPO_014426-RA 181 KFAHFTANQAILESFEGHTSVHVIDFSLMHGLQWPALIQALALRPGGPPSLRLTAVSLPSFHgHPDSFRETGIRLTQLARSINVTFSFRVVTIP 274
                      **********************************************************998899***************************999 PP

             GRAS 185 rledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpre 278
                      +l++++++ ++++p+E++aVn++lq h+ll   +s     + +Lk +++l+Pk+v++veqea+hn+++Fl rf+eal+yysa+fdslea    +
  AHYPO_014426-RA 275 QLDSINPWIFQTSPEEVVAVNSILQFHQLL---GSDI---NPILKSIQRLNPKIVTIVEQEANHNQPEFLIRFTEALHYYSAMFDSLEAC---H 359
                      *****************************9...3333...47*********************************************999...4 PP

             GRAS 279 seerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSa 372
                       e+ + v + +++rei+n+++ceg++r+erhe l+kW+ rl++aGFk++p++++a kqa++ll  +++dgy v+e++g+l lgW++rpL+++Sa
  AHYPO_014426-RA 360 LEATKPVAETYMQREICNILCCEGSARVERHEPLAKWQLRLSSAGFKALPMGHNALKQANMLLTLCSGDGYCVQENDGCLSLGWHNRPLIVASA 453
                      58888899999*********************************************************************************** PP

             GRAS 373 Wr 374
                      W+
  AHYPO_014426-RA 454 WQ 455
                      *6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098559.37372435IPR005202Transcription factor GRAS
PfamPF035142.3E-11898455IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 471 aa     Download sequence    Send to blast
MGPNNNVSGA FFAESNTVTD GFIGDSKGTK LVNTYPSPGS GSGSGLYTSL GYFDPISNEL  60
MKVVGDTWIN DRIEEQHRSH SEELTVFGDV EEDKEIRLVH ALLTCAESIQ HGELQLASSL  120
VGEITNELLT RVNTSSGIGK VACYFIDALS QRLYPSSLAS QGSLPNDVLY HYFYEACPYL  180
KFAHFTANQA ILESFEGHTS VHVIDFSLMH GLQWPALIQA LALRPGGPPS LRLTAVSLPS  240
FHGHPDSFRE TGIRLTQLAR SINVTFSFRV VTIPQLDSIN PWIFQTSPEE VVAVNSILQF  300
HQLLGSDINP ILKSIQRLNP KIVTIVEQEA NHNQPEFLIR FTEALHYYSA MFDSLEACHL  360
EATKPVAETY MQREICNILC CEGSARVERH EPLAKWQLRL SSAGFKALPM GHNALKQANM  420
LLTLCSGDGY CVQENDGCLS LGWHNRPLIV ASAWQTKIEN DDGSSSSSSS *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3g_A3e-6510545426378Protein SCARECROW
5b3h_A2e-6510545425377Protein SCARECROW
5b3h_D2e-6510545425377Protein SCARECROW
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcriptional regulator that acts as a repressor of the gibberellin (GA) signaling pathway. Probably acts by participating in large multiprotein complexes that repress transcription of GA-inducible genes. Upon GA application, it is degraded by the proteasome, allowing the GA signaling pathway.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010688103.10.0PREDICTED: DELLA protein GAI1
SwissprotQ8S4W71e-123GAI1_VITVI; DELLA protein GAI1
TrEMBLA0A0K9QD550.0A0A0K9QD55_SPIOL; Uncharacterized protein
STRINGXP_010688103.10.0(Beta vulgaris)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14920.11e-123GRAS family protein