PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AHYPO_014195-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Amaranthaceae; Amaranthus
Family GRAS
Protein Properties Length: 774aa    MW: 84715.8 Da    PI: 5.9545
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AHYPO_014195-RAgenomeBYUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS404.98e-1244037582374
             GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfsh 95 
                       +lLl+cAeavs++++++a+ +L ++se a+p g++ qR+aayf eA++arl++s  ++  +lp+ + +    ++ l+a+++f+ +sP++kfsh
  AHYPO_014195-RA 403 LTLLLQCAEAVSAEKFQEADGMLVEISEWATPFGTSAQRVAAYFSEAMSARLVSSRLGIHTSLPSIPHH----QKLLSAFQVFNGISPFVKFSH 492
                      579***************************************************999999999999886....8999***************** PP

             GRAS  96 ltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrledl 189
                      +taNqaI ea+++eervHiiD+di+qGlQWp L++ LasRp+gpp +R+Tg+g     s e+le+tg+rL++fAe+lg+pfef + va+++ +l
  AHYPO_014195-RA 493 FTANQAIQEAFQREERVHIIDLDIMQGLQWPGLFHILASRPGGPPFVRLTGLGT----SMEALEATGKRLSDFAEKLGLPFEFIP-VAEKIGNL 581
                      ******************************************************....***************************.7******* PP

             GRAS 190 eleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseeri 283
                      +le+L+v+++Ea+aV++    h+l+d ++s ++    +L+l+++l Pkvv+vveq++++ +++Fl rf+ea++yysalfdsl a+++++seer+
  AHYPO_014195-RA 582 DLEKLHVSKREAVAVHWLQ--HSLYDVTGSDTN----TLWLLQRLAPKVVTVVEQDLSR-TGTFLGRFVEAIHYYSALFDSLGASYGEDSEERH 668
                      ******************9..999999999999....********************99.899******************************* PP

             GRAS 284 kvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                      +vE++ll+rei+nv+a  g +r  + + + +Wre+l+++GF+ ++l  +aa+qa lll +++sdgy++ e++g+l lgWkd  L+++SaWr
  AHYPO_014195-RA 669 VVEQQLLSREIRNVLAIGGPSRSGDPK-FPSWREKLQQSGFRGISLAGNAAAQATLLLGMFPSDGYTLVEDNGTLKLGWKDLCLLTASAWR 758
                      *********************988887.**************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098561.008376738IPR005202Transcription factor GRAS
PfamPF035142.8E-121403758IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008356Biological Processasymmetric cell division
GO:0009630Biological Processgravitropism
GO:0009956Biological Processradial pattern formation
GO:0048366Biological Processleaf development
GO:0051457Biological Processmaintenance of protein location in nucleus
GO:0090610Biological Processbundle sheath cell fate specification
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 774 aa     Download sequence    Send to blast
MAASSTFFPD PNILLSPFYY ANNSINSQTN QSSNPFSNYS TSLFHLMSSS NPHTSTMDEN  60
VTHKMARKRT ASEMERPSPG SNDLIDQQQI SSVNDSGVFN AGNDQQQQQQ QQPLVCGFSG  120
LPLFPPVVER NVVMGSNSTR TSMGIMSNFS GSGLGSAVAA TPSSTEDPGW VDGIIKDLIQ  180
SSNSVSIPHL IQNVREIIYP CNPNLGAVIE FRLRSLADPP PVPQPTISQT QYHKQQNQQP  240
GFSRIHTGNS SQTSLNNKPY FNLSEMECFP QPTSIECSAN MNWGGVNVNT ANQISNPTQI  300
NDGCVGGSIN PTQIPNPTHT HLQPETCRVV EGTSDQNTES RETRDSDQGV GSGVRTEESP  360
SNTPTPPAPQ PPPPPQELTA VVKAREREEL RQRKRDEEGL HLLTLLLQCA EAVSAEKFQE  420
ADGMLVEISE WATPFGTSAQ RVAAYFSEAM SARLVSSRLG IHTSLPSIPH HQKLLSAFQV  480
FNGISPFVKF SHFTANQAIQ EAFQREERVH IIDLDIMQGL QWPGLFHILA SRPGGPPFVR  540
LTGLGTSMEA LEATGKRLSD FAEKLGLPFE FIPVAEKIGN LDLEKLHVSK REAVAVHWLQ  600
HSLYDVTGSD TNTLWLLQRL APKVVTVVEQ DLSRTGTFLG RFVEAIHYYS ALFDSLGASY  660
GEDSEERHVV EQQLLSREIR NVLAIGGPSR SGDPKFPSWR EKLQQSGFRG ISLAGNAAAQ  720
ATLLLGMFPS DGYTLVEDNG TLKLGWKDLC LLTASAWRPS HAHTMSTVCT RSQ*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3g_A0.03877594380Protein SCARECROW
5b3h_A0.03877593379Protein SCARECROW
5b3h_D0.03877593379Protein SCARECROW
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtPutative transcription factor involved in asymmetric cell division (By similarity). Required for differentiation of endodermis and graviresponses. {ECO:0000250, ECO:0000269|PubMed:16339910}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021860776.10.0protein SCARECROW 1
SwissprotQ2Z2E90.0SCR_IPONI; Protein SCARECROW
TrEMBLA0A0K9RLQ20.0A0A0K9RLQ2_SPIOL; Uncharacterized protein
STRINGXP_010691407.10.0(Beta vulgaris)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G54220.10.0GRAS family protein