PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AHYPO_014059-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Amaranthaceae; Amaranthus
Family LBD
Protein Properties Length: 69aa    MW: 7518.78 Da    PI: 8.7825
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AHYPO_014059-RAgenomeBYUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260401.1e-123367135
           DUF260  1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhk 35
                     +CaaCk+lrr+Ca++C+++pyf  ++p+kfa+vhk
  AHYPO_014059-RA 33 PCAACKLLRRRCAEECPFSPYFSPHEPQKFAAVHK 67
                     7*********************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089113.1873269IPR004883Lateral organ boundaries, LOB
PfamPF031951.2E-113367IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 69 aa     Download sequence    Send to blast
MVASNSCYNM MGVGPTPTPT PPPLGTPLNT ITPCAACKLL RRRCAEECPF SPYFSPHEPQ  60
KFAAVHKRT
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021716783.19e-31LOB domain-containing protein 15-like
SwissprotQ9AT614e-23LBD13_ARATH; LOB domain-containing protein 13
TrEMBLA0A0K9RA501e-24A0A0K9RA50_SPIOL; Uncharacterized protein
STRINGXP_010685965.13e-25(Beta vulgaris)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G30340.11e-19LOB domain-containing protein 13
Publications ? help Back to Top
  1. Cho C,Jeon E,Pandey SK,Ha SH,Kim J
    LBD13 positively regulates lateral root formation in Arabidopsis.
    Planta, 2019. 249(4): p. 1251-1258
    [PMID:30627888]