PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AHYPO_014030-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Amaranthaceae; Amaranthus
Family GRAS
Protein Properties Length: 606aa    MW: 66651.9 Da    PI: 4.7309
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AHYPO_014030-RAgenomeBYUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS356.54e-1092386041373
             GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfs 94 
                      l+++L+ecA+ +s++d e+a + L rl+e +s++gdp+qR+a+yfteAL  rl+         l+p   +++ s+e + ++k++++++P+ +f+
  AHYPO_014030-RA 238 LISALIECAR-LSESDPERAVKSLVRLRESVSQHGDPIQRVAFYFTEALYCRLSP-------PLSPPVVETTASEECTLSYKALNDACPFSTFA 323
                      5789******.67779**************************************9.......44444444456899999*************** PP

             GRAS  95 hltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegpp.slRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakr 185
                      hltaNqaIlea+eg++ +Hi+Df+i qG+QW+aLlqaLa+Rp+g+p ++Ri g+ +p+ g   + +l +tg+rL++fA+ l+++fef++ v + 
  AHYPO_014030-RA 324 HLTANQAILEATEGAQNIHIVDFGIVQGVQWAALLQALATRPSGKPnKVRISGIPAPALGesPASALFATGNRLREFARVLELNFEFEP-VLSP 416
                      ******************************************77776**********99998999************************.79** PP

             GRAS 186 ledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpres 279
                      +++l+++++rv+p+E+l Vn++lql++llde+    +   + L+l ksl+Pk+v++ e e+ +n+  +l+rf  a++yy a+f++le +l+r+s
  AHYPO_014030-RA 417 FNELTVSSFRVDPDEVLTVNFMLQLYTLLDETPIEVE---TALNLAKSLNPKIVTLGEYEVGLNRVGYLTRFKTAIKYYCAVFEALEPNLGRDS 507
                      *****************************77665555...9***************************************************** PP

             GRAS 280 eerikvErellgreivnvvacegae.rrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk.sdgyrveeesgslv.lgWkdrpLvsv 370
                       +r+ +Er+++gr+i+ +v  e    rrer+e+ e+W+  +e+aGF+ v+ s++a++qak ll +++ s  y++ +++  ++ l W+d pL++v
  AHYPO_014030-RA 508 VDRVQIERVIFGRRIMGCVGSELPGkRRERMESNEEWKGLMENAGFEMVAPSHYANSQAKILLWNYNySSSYKLMDSQPGFLsLAWNDVPLLTV 601
                      ********************998755*****************************************9999****99988888*********** PP

             GRAS 371 SaW 373
                      S+W
  AHYPO_014030-RA 602 SSW 604
                      *** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098557.716212583IPR005202Transcription factor GRAS
PfamPF035141.4E-106238604IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 606 aa     Download sequence    Send to blast
MAYMCTDSGN LMAIAQQVIK QQQQQQEQQQ QNHHHQNHHP QFLGPNSPFF LSPWAPPVPH  60
MSTSPPPPLG FSGAGFHDPF QLGAPPTDSN EAWQLDHHST SFRFADFCSG GAPEFDSDEW  120
MESLMSAGAA PESTGANESS NLQSACDAWQ GVSSADFNIY GVDPFATCPS RVNVTISPPS  180
DLNRVLYSDA DKTVTAQAWV PPPQKDPSPK TDSPQTRNDA VAVVSSSIDE GVHSWPPLIS  240
ALIECARLSE SDPERAVKSL VRLRESVSQH GDPIQRVAFY FTEALYCRLS PPLSPPVVET  300
TASEECTLSY KALNDACPFS TFAHLTANQA ILEATEGAQN IHIVDFGIVQ GVQWAALLQA  360
LATRPSGKPN KVRISGIPAP ALGESPASAL FATGNRLREF ARVLELNFEF EPVLSPFNEL  420
TVSSFRVDPD EVLTVNFMLQ LYTLLDETPI EVETALNLAK SLNPKIVTLG EYEVGLNRVG  480
YLTRFKTAIK YYCAVFEALE PNLGRDSVDR VQIERVIFGR RIMGCVGSEL PGKRRERMES  540
NEEWKGLMEN AGFEMVAPSH YANSQAKILL WNYNYSSSYK LMDSQPGFLS LAWNDVPLLT  600
VSSWH*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-1372376053375GRAS family transcription factor containing protein, expressed
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in plant development (By similarity). Involved in environmental abiotic stress resistance. May increase the expression of stress-responsive genes (PubMed:20616154). Binds DNA in vitro (By similarity). {ECO:0000250|UniProtKB:Q53K16, ECO:0000250|UniProtKB:Q9SCR0, ECO:0000269|PubMed:20616154}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Up-regulated by drought and high salt stresses, and down-regulated by gibberellic acid (GA) treatment, but not by plant hormone abscisic acid (ABA) application in leaves. Under the salt treatment, expression is induced quickly, and it peaks at 3 hours. Under the drought treatment, the expression is not induced immediately, but reaches its maximum at 3 hours. Under the GA treatment, the expression becomes weaker within 5 hours. {ECO:0000269|PubMed:20616154}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021714509.10.0LOW QUALITY PROTEIN: scarecrow-like protein 4
SwissprotA0A024B7I00.0SCL7_POPEU; SCARECROW-LIKE protein 7
TrEMBLA0A0K9QGY40.0A0A0K9QGY4_SPIOL; Uncharacterized protein
STRINGXP_010679714.10.0(Beta vulgaris)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66770.10.0GRAS family protein