PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AHYPO_013737-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Amaranthaceae; Amaranthus
Family VOZ
Protein Properties Length: 515aa    MW: 57721.5 Da    PI: 6.2071
Description VOZ family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AHYPO_013737-RAgenomeBYUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1VOZ386.95.2e-1192754921217
              VOZ   1 pppsaflgpkcalwdctrpaqgsewlqdycssfhatlalneglpgttpvlrpkgidlkdgllfaalsakvqgkevgipecegaatakspwnaae 94 
                      ppp+aflgpkcalwdc+rpaqgse +++ycs +ha+la++e +pgt+p+lrp+gi+lkdg++faal++k +gk+vgipec gaat+kspwn++e
  AHYPO_013737-RA 275 PPPAAFLGPKCALWDCARPAQGSEYCKNYCSGYHADLAMKECPPGTSPILRPGGIGLKDGPIFAALKSKLEGKNVGIPECIGAATSKSPWNTPE 368
                      89******************************************************************************************** PP

              VOZ  95 lfdlsllegetirewlffdkprrafesgnrkqrslpdysgrgwhesrkqvmkefgglkrsyymdpqpsssfewhlyeyeineldalalyrlelk 188
                      lf++s+lege +rewlffdkprrafe+gnrkqrslpd++grgwhesrkq+mke+gg+krsyy dpqp + +ewhl+eye+++++ +alyrlelk
  AHYPO_013737-RA 369 LFNISILEGEKVREWLFFDKPRRAFETGNRKQRSLPDHEGRGWHESRKQIMKEYGGQKRSYYADPQPHKDLEWHLFEYEMDSCNVCALYRLELK 462
                      ********************************************************************************************** PP

              VOZ 189 lvde.kksakgkvskdsladlqkklgrlta 217
                      ++de k+s+k+k ++d+l dlqk++grlta
  AHYPO_013737-RA 463 VADErKRSPKTKGTTDPLLDLQKRMGRLTA 492
                      **9735699*******************97 PP

Sequence ? help Back to Top
Protein Sequence    Length: 515 aa     Download sequence    Send to blast
MGKDSKSCKQ PSHQLLKCQA KNRVEDIQSM LNELQVARKE SRTGDAATLE EQVNQILNEW  60
KAELNEPTPA SSLLEDSFGS FSKELGQLLQ QFEVEDDATS PLTAPSSARN GDSVHAPALS  120
GSLRDEEIRY LNHVTQQQSS QGYTPQQHEF IGPELHVSQR HGFPVFDSHI SQQKFPGFGN  180
HGIQNHILQP QDYQGLEDCN GAVNSMQGRL INNFEASGLH NMLPNNFEMT TQLDFLHLDK  240
HENLDSEVFI NASGIEHWGL DDISDFSNMF PNVNPPPAAF LGPKCALWDC ARPAQGSEYC  300
KNYCSGYHAD LAMKECPPGT SPILRPGGIG LKDGPIFAAL KSKLEGKNVG IPECIGAATS  360
KSPWNTPELF NISILEGEKV REWLFFDKPR RAFETGNRKQ RSLPDHEGRG WHESRKQIMK  420
EYGGQKRSYY ADPQPHKDLE WHLFEYEMDS CNVCALYRLE LKVADERKRS PKTKGTTDPL  480
LDLQKRMGRL TAEVSAENKR SGKGKAKFDE KSDH*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010689762.10.0PREDICTED: transcription factor VOZ1
TrEMBLA0A0K9S0440.0A0A0K9S044_SPIOL; Uncharacterized protein
STRINGXP_010689762.10.0(Beta vulgaris)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G42400.11e-124vascular plant one zinc finger protein 2