PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AHYPO_013710-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Amaranthaceae; Amaranthus
Family WOX
Protein Properties Length: 189aa    MW: 21509.2 Da    PI: 9.2421
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AHYPO_013710-RAgenomeBYUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox64.81.2e-203899157
                     TT--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
         Homeobox  1 rrkRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57
                     ++ R+++t+eq+++L +lF+   r+ps++++++++++l    +++ ++V++WFqN++a+e++
  AHYPO_013710-RA 38 KCGRWNPTAEQVKVLTDLFRAgLRTPSTDQIQKISTQLsfygKIESKNVFYWFQNHKARERQ 99
                     568*****************99**************************************97 PP

2Wus_type_Homeobox113.41.1e-3638101265
  Wus_type_Homeobox   2 artRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65 
                        ++ RW+Pt+eQ+k+L++l+++GlrtP++++iq+i+++L+ yGkie+kNVfyWFQN+kaRerqk+
    AHYPO_013710-RA  38 KCGRWNPTAEQVKVLTDLFRAGLRTPSTDQIQKISTQLSFYGKIESKNVFYWFQNHKARERQKR 101
                        678***********************************************************95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.07E-1131103IPR009057Homeodomain-like
PROSITE profilePS5007110.88435100IPR001356Homeobox domain
SMARTSM003895.4E-437104IPR001356Homeobox domain
PfamPF000469.7E-183999IPR001356Homeobox domain
CDDcd000863.42E-441101No hitNo description
Gene3DG3DSA:1.10.10.608.1E-84199IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009733Biological Processresponse to auxin
GO:0010078Biological Processmaintenance of root meristem identity
GO:1902459Biological Processpositive regulation of stem cell population maintenance
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 189 aa     Download sequence    Send to blast
MEDNNHGISG FCIQTQGTKS RVGCYGGGPG GAPNSGTKCG RWNPTAEQVK VLTDLFRAGL  60
RTPSTDQIQK ISTQLSFYGK IESKNVFYWF QNHKARERQK RRRVSKDQFD SPCFQFDDHL  120
KPFAPPPTKY RAIETLQLFP LNSYHNQESD KLRMFSNECC KENNATFAAY TITKDLDHPP  180
LDLRLSFF*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
199103KRRRV
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor, which may be involved in the specification and maintenance of the stem cells (QC cells) in the root apical meristem (RAM). {ECO:0000269|PubMed:25631790}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021768966.19e-97WUSCHEL-related homeobox 5-like
SwissprotQ8H1D25e-54WOX5_ARATH; WUSCHEL-related homeobox 5
TrEMBLA0A498KT192e-66A0A498KT19_MALDO; Uncharacterized protein
STRINGXP_010689998.17e-86(Beta vulgaris)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G11260.14e-55WUSCHEL related homeobox 5
Publications ? help Back to Top
  1. Conte MG,Gaillard S,Droc G,Perin C
    Phylogenomics of plant genomes: a methodology for genome-wide searches for orthologs in plants.
    BMC Genomics, 2008. 9: p. 183
    [PMID:18426584]
  2. Chu H, et al.
    A CLE-WOX signalling module regulates root meristem maintenance and vascular tissue development in rice.
    J. Exp. Bot., 2013. 64(17): p. 5359-69
    [PMID:24043854]
  3. Tian H,Niu T,Yu Q,Quan T,Ding Z
    Auxin gradient is crucial for the maintenance of root distal stem cell identity in Arabidopsis.
    Plant Signal Behav, 2013. 8(12): p. e26429
    [PMID:24056047]
  4. Tian H,Jia Y,Niu T,Yu Q,Ding Z
    The key players of the primary root growth and development also function in lateral roots in Arabidopsis.
    Plant Cell Rep., 2014. 33(5): p. 745-53
    [PMID:24504658]
  5. Reyes-Hernández BJ, et al.
    The root indeterminacy-to-determinacy developmental switch is operated through a folate-dependent pathway in Arabidopsis thaliana.
    New Phytol., 2014. 202(4): p. 1223-36
    [PMID:24635769]
  6. Bennett T,van den Toorn A,Willemsen V,Scheres B
    Precise control of plant stem cell activity through parallel regulatory inputs.
    Development, 2014. 141(21): p. 4055-64
    [PMID:25256342]
  7. Ji H, et al.
    PRL1 modulates root stem cell niche activity and meristem size through WOX5 and PLTs in Arabidopsis.
    Plant J., 2015. 81(3): p. 399-412
    [PMID:25438658]
  8. Su YH,Liu YB,Bai B,Zhang XS
    Establishment of embryonic shoot-root axis is involved in auxin and cytokinin response during Arabidopsis somatic embryogenesis.
    Front Plant Sci, 2014. 5: p. 792
    [PMID:25642237]
  9. Jia Y, et al.
    The Arabidopsis thaliana elongator complex subunit 2 epigenetically affects root development.
    J. Exp. Bot., 2015. 66(15): p. 4631-42
    [PMID:25998905]
  10. Zhang M, et al.
    A tetratricopeptide repeat domain-containing protein SSR1 located in mitochondria is involved in root development and auxin polar transport in Arabidopsis.
    Plant J., 2015. 83(4): p. 582-99
    [PMID:26072661]
  11. Kong X,Lu S,Tian H,Ding Z
    WOX5 is Shining in the Root Stem Cell Niche.
    Trends Plant Sci., 2015. 20(10): p. 601-603
    [PMID:26440429]
  12. Hu X,Xu L
    Transcription Factors WOX11/12 Directly Activate WOX5/7 to Promote Root Primordia Initiation and Organogenesis.
    Plant Physiol., 2016. 172(4): p. 2363-2373
    [PMID:27784768]
  13. Zhang Y,Jiao Y,Jiao H,Zhao H,Zhu YX
    Two-Step Functional Innovation of the Stem-Cell Factors WUS/WOX5 during Plant Evolution.
    Mol. Biol. Evol., 2017. 34(3): p. 640-653
    [PMID:28053005]
  14. Singh S, et al.
    Sirtinol, a Sir2 protein inhibitor, affects stem cell maintenance and root development in Arabidopsis thaliana by modulating auxin-cytokinin signaling components.
    Sci Rep, 2017. 7: p. 42450
    [PMID:28195159]
  15. García-Gómez ML,Azpeitia E,Álvarez-Buylla ER
    A dynamic genetic-hormonal regulatory network model explains multiple cellular behaviors of the root apical meristem of Arabidopsis thaliana.
    PLoS Comput. Biol., 2017. 13(4): p. e1005488
    [PMID:28426669]
  16. Long Y, et al.
    In vivo FRET-FLIM reveals cell-type-specific protein interactions in Arabidopsis roots.
    Nature, 2017. 548(7665): p. 97-102
    [PMID:28746306]
  17. Bruno L, et al.
    In Arabidopsis thaliana Cadmium Impact on the Growth of Primary Root by Altering SCR Expression and Auxin-Cytokinin Cross-Talk.
    Front Plant Sci, 2017. 8: p. 1323
    [PMID:28798767]
  18. Hu B, et al.
    Divergent regeneration-competent cells adopt a common mechanism for callus initiation in angiosperms.
    Regeneration (Oxf), 2017. 4(3): p. 132-139
    [PMID:28975033]
  19. Lozano-Elena F,Planas-Riverola A,Vilarrasa-Blasi J,Schwab R,Caño-Delgado AI
    Paracrine brassinosteroid signaling at the stem cell niche controls cellular regeneration.
    J. Cell. Sci., 2019.
    [PMID:29242230]
  20. Xu C, et al.
    Control of auxin-induced callus formation by bZIP59-LBD complex in Arabidopsis regeneration.
    Nat Plants, 2018. 4(2): p. 108-115
    [PMID:29358751]
  21. Dolzblasz A, et al.
    Impairment of Meristem Proliferation in Plants Lacking the Mitochondrial Protease AtFTSH4.
    Int J Mol Sci, 2018.
    [PMID:29538317]