PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AHYPO_013471-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Amaranthaceae; Amaranthus
Family LBD
Protein Properties Length: 180aa    MW: 20091.6 Da    PI: 7.0709
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AHYPO_013471-RAgenomeBYUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260128.23.8e-40131121100
           DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkael 94 
                      +CaaCk+l+r+C+++C++apyf a++pkkfa vhk+FGasnv+k+l+++pe +re++++sl yeAear++dPvyG++g i  lq ++ ql+++l
  AHYPO_013471-RA  13 SCAACKLLKRRCSSNCIFAPYFRADEPKKFAKVHKVFGASNVSKILNEVPEYQREETVNSLSYEAEARLQDPVYGCIGAIAFLQTRMFQLQHDL 106
                      6********************************************************************************************* PP

           DUF260  95 allkee 100
                      al++++
  AHYPO_013471-RA 107 ALAQAR 112
                      *99976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.37812113IPR004883Lateral organ boundaries, LOB
PfamPF031956.6E-3913110IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 180 aa     Download sequence    Send to blast
MKNGHNEPRS SSSCAACKLL KRRCSSNCIF APYFRADEPK KFAKVHKVFG ASNVSKILNE  60
VPEYQREETV NSLSYEAEAR LQDPVYGCIG AIAFLQTRMF QLQHDLALAQ ARLAQYRTSG  120
TVLHSNINTD TTNNNVNIIH MNLCREEHII SSDQFNQSDS CGYDTITSDF GQVPDLLPL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A4e-4581166114LOB family transfactor Ramosa2.1
5ly0_B4e-4581166114LOB family transfactor Ramosa2.1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021732655.11e-91LOB domain-containing protein 21-like
SwissprotQ9SRL84e-57LBD21_ARATH; LOB domain-containing protein 21
TrEMBLA0A0K9QQM52e-81A0A0K9QQM5_SPIOL; Uncharacterized protein
STRINGXP_010689397.19e-83(Beta vulgaris)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G11090.13e-51LOB domain-containing protein 21
Publications ? help Back to Top
  1. Weber AP,Weber KL,Carr K,Wilkerson C,Ohlrogge JB
    Sampling the Arabidopsis transcriptome with massively parallel pyrosequencing.
    Plant Physiol., 2007. 144(1): p. 32-42
    [PMID:17351049]