PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AHYPO_012903-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Amaranthaceae; Amaranthus
Family LBD
Protein Properties Length: 108aa    MW: 11893.8 Da    PI: 8.2141
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AHYPO_012903-RAgenomeBYUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260139.21.4e-4371061100
           DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkael 94 
                      +Ca+Ck+lrr+C+k+C++apyfp ++p++f  vhklFGasnv+kll++lpe++r da+sslv+eA+ar++dPvyG+vg i+ lq+q++ql+ +l
  AHYPO_012903-RA   7 PCASCKLLRRRCVKECIFAPYFPPDDPQRFGLVHKLFGASNVSKLLQELPENKRADAVSSLVFEANARIKDPVYGCVGAISLLQNQVSQLQMQL 100
                      7********************************************************************************************* PP

           DUF260  95 allkee 100
                      +++++e
  AHYPO_012903-RA 101 EQAHAE 106
                      *99987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.0396107IPR004883Lateral organ boundaries, LOB
PfamPF031951.0E-427104IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 108 aa     Download sequence    Send to blast
MGSGSSPCAS CKLLRRRCVK ECIFAPYFPP DDPQRFGLVH KLFGASNVSK LLQELPENKR  60
ADAVSSLVFE ANARIKDPVY GCVGAISLLQ NQVSQLQMQL EQAHAELM
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A3e-5021087112LOB family transfactor Ramosa2.1
5ly0_B3e-5021087112LOB family transfactor Ramosa2.1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010685903.22e-64PREDICTED: LOB domain-containing protein 12
SwissprotQ8LBW36e-61LBD12_ARATH; LOB domain-containing protein 12
TrEMBLA0A314KUE51e-61A0A314KUE5_NICAT; Lob domain-containing protein 12
STRINGXP_009760471.12e-62(Nicotiana sylvestris)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G30130.13e-63LBD family protein
Publications ? help Back to Top
  1. Penfield S, et al.
    Reserve mobilization in the Arabidopsis endosperm fuels hypocotyl elongation in the dark, is independent of abscisic acid, and requires PHOSPHOENOLPYRUVATE CARBOXYKINASE1.
    Plant Cell, 2004. 16(10): p. 2705-18
    [PMID:15367715]