PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AHYPO_012611-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Amaranthaceae; Amaranthus
Family bHLH
Protein Properties Length: 92aa    MW: 10443 Da    PI: 6.7942
Description bHLH family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AHYPO_012611-RAgenomeBYUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HLH23.41.1e-0717561554
                     HHHHHHHHHHCTSCCC...TTS-STCHHHHHHHHHHHHHH CS
              HLH 15 riNsafeeLrellPkaskapskKlsKaeiLekAveYIksL 54
                     +i + +++L+ llP++ +++ +++ K +iL+++++YI++L
  AHYPO_012611-RA 17 EISELIFKLQALLPERNHGHLRRVPKDQILKEVCKYIRKL 56
                     69999**********76888899***************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS508888.772256IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene3DG3DSA:4.10.280.105.5E-81675IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
SuperFamilySSF474592.36E-71674IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
PfamPF000104.2E-51756IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 92 aa     Download sequence    Send to blast
MSSSRGSLAS RINANEEISE LIFKLQALLP ERNHGHLRRV PKDQILKEVC KYIRKLNKEV  60
ENMSERISEV LGSVDHIGLL DEDVINTLLQ Y*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021761654.15e-31transcription factor PRE6-like
TrEMBLA0A0K9R6S42e-25A0A0K9R6S4_SPIOL; Uncharacterized protein
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G26945.11e-14bHLH family protein