PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AHYPO_012417-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Amaranthaceae; Amaranthus
Family LBD
Protein Properties Length: 196aa    MW: 21845.5 Da    PI: 6.2271
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AHYPO_012417-RAgenomeBYUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260123.61e-38141131100
           DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkael 94 
                      +CaaCk+l+r+C+ +C++apyf a++ +kfanvhk+FGasnv+k+l+++pee+re++++sl++eAear++dPvyG++g i  lq q+ ql+++l
  AHYPO_012417-RA  14 SCAACKLLKRRCSLSCIFAPYFRANELRKFANVHKVFGASNVSKILNEVPEEHREETVNSLLFEAEARLQDPVYGCLGAIALLQTQMFQLEHDL 107
                      6********************************************************************************************* PP

           DUF260  95 allkee 100
                      ++++++
  AHYPO_012417-RA 108 SVARAR 113
                      998875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.01913114IPR004883Lateral organ boundaries, LOB
PfamPF031959.8E-3814111IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 196 aa     Download sequence    Send to blast
MKKGYNNEPR SSSSCAACKL LKRRCSLSCI FAPYFRANEL RKFANVHKVF GASNVSKILN  60
EVPEEHREET VNSLLFEAEA RLQDPVYGCL GAIALLQTQM FQLEHDLSVA RARLAQYKAA  120
SSLCADNYSN NNIFNYNVSE NDLFGLGDHH NNVNNNHMNL CKEEYLICSD QFSQSDGGGY  180
CATNDFGLVP DLFPL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A8e-4271174114LOB family transfactor Ramosa2.1
5ly0_B8e-4271174114LOB family transfactor Ramosa2.1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021732655.13e-89LOB domain-containing protein 21-like
SwissprotQ9SRL88e-56LBD21_ARATH; LOB domain-containing protein 21
TrEMBLA0A0K9QQM58e-84A0A0K9QQM5_SPIOL; Uncharacterized protein
STRINGXP_010689397.18e-79(Beta vulgaris)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G11090.12e-57LOB domain-containing protein 21
Publications ? help Back to Top
  1. Weber AP,Weber KL,Carr K,Wilkerson C,Ohlrogge JB
    Sampling the Arabidopsis transcriptome with massively parallel pyrosequencing.
    Plant Physiol., 2007. 144(1): p. 32-42
    [PMID:17351049]