PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AHYPO_012399-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Amaranthaceae; Amaranthus
Family LBD
Protein Properties Length: 176aa    MW: 19526.1 Da    PI: 6.654
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AHYPO_012399-RAgenomeBYUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260144.33.7e-4581071100
           DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkael 94 
                      +Ca+Ck+lrr+CakdC++apyfp+++p+kfa+vhk+FGasnv+k+l++lp ++r da+sslvyeA+ar+rdPvyG+vg i+ lq+q++ql+ +l
  AHYPO_012399-RA   8 PCASCKLLRRRCAKDCIFAPYFPSDDPHKFAIVHKVFGASNVSKMLQELPVQQRADAVSSLVYEANARMRDPVYGCVGAISFLQNQVSQLQMQL 101
                      7********************************************************************************************* PP

           DUF260  95 allkee 100
                      a++++e
  AHYPO_012399-RA 102 AVAQAE 107
                      **9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.8897108IPR004883Lateral organ boundaries, LOB
PfamPF031953.8E-448105IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009965Biological Processleaf morphogenesis
Sequence ? help Back to Top
Protein Sequence    Length: 176 aa     Download sequence    Send to blast
MGGNGTSPCA SCKLLRRRCA KDCIFAPYFP SDDPHKFAIV HKVFGASNVS KMLQELPVQQ  60
RADAVSSLVY EANARMRDPV YGCVGAISFL QNQVSQLQMQ LAVAQAEILC IQMQQEPSNM  120
GNSVQNNFEA VDDKSFLFQN NISQQQYLNF PSSSEHHVIQ DSLKRESFFG HDMVS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A4e-47712010126LOB family transfactor Ramosa2.1
5ly0_B4e-47712010126LOB family transfactor Ramosa2.1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010692935.11e-114PREDICTED: LOB domain-containing protein 12-like
SwissprotQ8LBW31e-76LBD12_ARATH; LOB domain-containing protein 12
TrEMBLA0A0K9QFW01e-110A0A0K9QFW0_SPIOL; Uncharacterized protein
STRINGXP_010692935.11e-113(Beta vulgaris)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G30130.15e-79LBD family protein
Publications ? help Back to Top
  1. Penfield S, et al.
    Reserve mobilization in the Arabidopsis endosperm fuels hypocotyl elongation in the dark, is independent of abscisic acid, and requires PHOSPHOENOLPYRUVATE CARBOXYKINASE1.
    Plant Cell, 2004. 16(10): p. 2705-18
    [PMID:15367715]