PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AHYPO_011957-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Amaranthaceae; Amaranthus
Family GRAS
Protein Properties Length: 701aa    MW: 79664.5 Da    PI: 7.3141
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AHYPO_011957-RAgenomeBYUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS376.24.2e-1153216921374
             GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfs 94 
                      l++lL  cA+av s+d++ a+ lL+++++++sp+gd +qR+a+yf+ +L+arla+ ++ +yk l + ++     ++ l a+++f  v+P+ k++
  AHYPO_011957-RA 321 LRSLLSLCAQAVGSNDQRSANDLLQQIRQHSSPTGDGNQRMAHYFADGLEARLAGVGTPIYKCLLTGPAC---AVDILRAYHMFLAVCPFKKIG 411
                      578999*******************************************************999888887...9******************** PP

             GRAS  95 hltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrl 186
                      ++  N++I e +e+++r+HiiD+++ +G+QWp+L+q L+sRp+gpp++RiTgv+ p++g   +++leetg+rL+++Ae++++pfefn+ vak++
  AHYPO_011957-RA 412 NFFSNRTITEVAEKATRLHIIDIGMVYGFQWPCLFQRLSSRPGGPPNIRITGVDLPQPGfrPSKRLEETGRRLKNYAESFNIPFEFNA-VAKKW 504
                      **********************************************************9*****************************.7**** PP

             GRAS 187 edleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklprese 280
                      e++++e+L+++++E l+Vn+ ++ +++++e++ ++ +rd +L+lv++++P +++    +   ns+ F +rf eal ++s+lfd+++++lpr+  
  AHYPO_011957-RA 505 ETVNVEDLKLDTDELLVVNCLFRFKYIPEETAMVDCPRDMLLNLVRQIKPAIFIQGAVNGAFNSPFFITRFREALFHFSTLFDMIDTNLPRDIP 598
                      ****************************99999999********************************************************** PP

             GRAS 281 erikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                      eri +Ere++gr+++nv+aceg er+er et+++W+ r e++GF+++pl+ ++++ ak  ++ v+ + ++++e+ ++l+lgWk+r +++++ W+
  AHYPO_011957-RA 599 ERILIEREIFGRQAMNVIACEGLERIERPETYKQWQVRNERVGFNQLPLKPEIVAMAKKRVKSVYHKDFSIDEDGHWLLLGWKGRIVYALTNWK 692
                      *****************************************************************888*************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098566.335295672IPR005202Transcription factor GRAS
PfamPF035141.5E-112321692IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 701 aa     Download sequence    Send to blast
MDPQLEELYG TLHRFKFNDQ KVPFYPNTLQ DPNLHPNFVN TVKLQESNPI NSQNPNFNLV  60
VPSVGQEFDT SLHEDYDFSD VVLKYINQVL MEEDEEEKAR VNHEPSALAA AERTLYESYI  120
SPSNSRRQYG VLEFNFEKSM SSGSSVGGYV DTSVESPVSA LNVSKIFNEG QSILQFQKGV  180
EEARKFLPKD PLYTGLIIDG SFPNLDNVVS KESGVDLENR GENEGLARVF GGKKNRNRDE  240
VVSEEKRDSK QSANSFIPDE AVKRSEMWDR VLLCSGGKHD AVLREALQSE LNKNAQINQA  300
KGSNSGKGRG RRKGKREVID LRSLLSLCAQ AVGSNDQRSA NDLLQQIRQH SSPTGDGNQR  360
MAHYFADGLE ARLAGVGTPI YKCLLTGPAC AVDILRAYHM FLAVCPFKKI GNFFSNRTIT  420
EVAEKATRLH IIDIGMVYGF QWPCLFQRLS SRPGGPPNIR ITGVDLPQPG FRPSKRLEET  480
GRRLKNYAES FNIPFEFNAV AKKWETVNVE DLKLDTDELL VVNCLFRFKY IPEETAMVDC  540
PRDMLLNLVR QIKPAIFIQG AVNGAFNSPF FITRFREALF HFSTLFDMID TNLPRDIPER  600
ILIEREIFGR QAMNVIACEG LERIERPETY KQWQVRNERV GFNQLPLKPE IVAMAKKRVK  660
SVYHKDFSID EDGHWLLLGW KGRIVYALTN WKPGFPNFLR Q
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A7e-513216925375GRAS family transcription factor containing protein, expressed
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_019107225.10.0PREDICTED: scarecrow-like protein 33
RefseqXP_019107229.10.0PREDICTED: scarecrow-like protein 33
TrEMBLA0A0K9RZZ50.0A0A0K9RZZ5_SPIOL; Uncharacterized protein
STRINGXP_010690788.10.0(Beta vulgaris)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07530.11e-177SCARECROW-like 14