PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AHYPO_011715-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Amaranthaceae; Amaranthus
Family LBD
Protein Properties Length: 640aa    MW: 69086.3 Da    PI: 7.3078
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AHYPO_011715-RAgenomeBYUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260127.85.1e-4071061100
           DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkael 94 
                      +CaaCk++r+kC++dCv+apyfp ++ +kf nvhk++Gasnv kll+++++++reda++slvyeAe r+ dP++G+++v+++lqqql+++++++
  AHYPO_011715-RA   7 PCAACKLQRKKCTQDCVYAPYFPPDKLEKFLNVHKVYGASNVAKLLNEVKPSQREDAVNSLVYEAELRLIDPINGCIAVVSALQQQLQSVQSDV 100
                      7********************************************************************************************* PP

           DUF260  95 allkee 100
                      al+ +e
  AHYPO_011715-RA 101 ALATKE 106
                      999876 PP

2DUF260128.33.5e-402963961101
           DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkael 94 
                      +Ca+Ck+lrrkC++dC +apyfp +qpkkf  vhk++Gasnv kll++l++++reda++sl+yeAe+r++dP++G+v+v+ +lqqql++ ++++
  AHYPO_011715-RA 296 PCAGCKFLRRKCTQDCLYAPYFPPDQPKKFSTVHKVYGASNVAKLLNELNPSQREDAANSLAYEAEMRLSDPINGCVAVVYALQQQLQSIQSNV 389
                      7********************************************************************************************* PP

           DUF260  95 allkeel 101
                      +l++++l
  AHYPO_011715-RA 390 KLARKQL 396
                      *999885 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.9456107IPR004883Lateral organ boundaries, LOB
PfamPF031956.8E-397103IPR004883Lateral organ boundaries, LOB
PROSITE profilePS5089125.879295396IPR004883Lateral organ boundaries, LOB
PfamPF031956.6E-39296393IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 640 aa     Download sequence    Send to blast
MLPIGSPCAA CKLQRKKCTQ DCVYAPYFPP DKLEKFLNVH KVYGASNVAK LLNEVKPSQR  60
EDAVNSLVYE AELRLIDPIN GCIAVVSALQ QQLQSVQSDV ALATKELASL LNPYSGCLGP  120
MMGSHSDVVA SPGAASSHVG IGQQLVIIGP QNQQQSIEAH QLAAIAAKQE QDVMMRNWEH  180
QPVIRLSGVS GSCSGSGSVC GGYEGRMIVN SSSGGGGGRG GGGEYSQAGP TLANAQPSLA  240
VGASAFDPMA YNNQIQQHEI HEQQHQHHQE HEQQHQHQQE NEQQLVEERM SSSGSPCAGC  300
KFLRRKCTQD CLYAPYFPPD QPKKFSTVHK VYGASNVAKL LNELNPSQRE DAANSLAYEA  360
EMRLSDPING CVAVVYALQQ QLQSIQSNVK LARKQLSSYI GTAGVKSFLN QYSYAYLATA  420
TAASSSSSVN QQINMGLGQR QCLSPVPMRV IPSGVVASPG AVSSHVGIGQ SSVIRGPQNQ  480
QQQQAIEAHQ LAAIAARKEQ DVMMRNLQHQ QLTRLGGSSA SGGYSGRMII NHSIGGAGGG  540
SAGGDYNQVG FSLANAQPSL ALGAFGIDHM AQQHQHQQQH EQQVDESLRQ FLLREQLATT  600
QPHQGHVDQL GQGNQQLLQH HRHQQQQQHD LQHQQQEKIM
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A9e-3953998114LOB family transfactor Ramosa2.1
5ly0_B9e-3953998114LOB family transfactor Ramosa2.1
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1216222GGRGGGG
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010687953.14e-71PREDICTED: LOB domain-containing protein 36
STRINGXP_010687953.11e-70(Beta vulgaris)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66870.12e-44ASYMMETRIC LEAVES 2-like 1