PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AHYPO_009474-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Amaranthaceae; Amaranthus
Family LBD
Protein Properties Length: 170aa    MW: 19378.1 Da    PI: 8.1228
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AHYPO_009474-RAgenomeBYUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260125.13.4e-396103198
           DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkael 94 
                      +CaaCk+lrr+C+kdC++ pyfp+++ ++fa+vhk+FGasnv k+lk+lpee+r++a++slv+eA+ r+r+PvyG+vg+i++l+ q+++++ el
  AHYPO_009474-RA   6 RCAACKYLRRRCPKDCIFGPYFPSSNIERFACVHKIFGASNVAKMLKDLPEERRREAAESLVMEARFRVRNPVYGSVGIINQLRLQIMEAEYEL 99 
                      6********************************************************************************************9 PP

           DUF260  95 allk 98 
                      a+++
  AHYPO_009474-RA 100 ARTQ 103
                      9886 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.6245106IPR004883Lateral organ boundaries, LOB
PfamPF031957.7E-396103IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 170 aa     Download sequence    Send to blast
MSNSSRCAAC KYLRRRCPKD CIFGPYFPSS NIERFACVHK IFGASNVAKM LKDLPEERRR  60
EAAESLVMEA RFRVRNPVYG SVGIINQLRL QIMEAEYELA RTQGLLALYH AQAQYVHNHQ  120
NNILQPIEAI TFTPQNQDDH SLLLGPQQEQ CTSSSFINGL TTYEPFMYN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A7e-304999104LOB family transfactor Ramosa2.1
5ly0_B7e-304999104LOB family transfactor Ramosa2.1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00381DAPTransfer from AT3G26620Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021761801.13e-70LOB domain-containing protein 24-like
SwissprotP594673e-45LBD23_ARATH; LOB domain-containing protein 23
TrEMBLA0A0J8B8811e-69A0A0J8B881_BETVU; Uncharacterized protein
STRINGXP_010278070.12e-45(Nelumbo nucifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G26620.11e-47LOB domain-containing protein 23