PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AHYPO_008475-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Amaranthaceae; Amaranthus
Family NF-YC
Protein Properties Length: 134aa    MW: 14701.9 Da    PI: 6.2629
Description NF-YC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AHYPO_008475-RAgenomeBYUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YC62.11.1e-196861898
            NF-YC 18 nhelPlarikkilkadedvkmisaeaPvllskacelfileltlrswlhaeenkrrtlkksdiaaavtrtdifdflvdivpr 98
                     ++++P arikki++adedv +i+  +Pvl+ska elf+ +l  r++  + +   +t+    ++ ++ +  +fdfl d+v +
  AHYPO_008475-RA  6 DTRFPAARIKKIMQADEDVGKIAMAVPVLVSKALELFLQDLCDRTYDVTLQRGAKTMSSLHLKHCIHSFSMFDFLKDVVSK 86
                     5789**************************************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF471132.73E-21389IPR009072Histone-fold
Gene3DG3DSA:1.10.20.106.5E-27372IPR009072Histone-fold
PfamPF008086.1E-19871IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005829Cellular Componentcytosol
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 134 aa     Download sequence    Send to blast
MRKKLDTRFP AARIKKIMQA DEDVGKIAMA VPVLVSKALE LFLQDLCDRT YDVTLQRGAK  60
TMSSLHLKHC IHSFSMFDFL KDVVSKVPDY GQSDANADDR SATKRSKKQA MPAAVVEDEA  120
EAEGEVADGE GLL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1jfi_A1e-25272575Transcription Regulator NC2 alpha chain
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010670583.15e-69PREDICTED: dr1-associated corepressor
TrEMBLA0A0K9RC392e-70A0A0K9RC39_SPIOL; Uncharacterized protein
STRINGVIT_13s0084g00040.t017e-60(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G12480.12e-59nuclear factor Y, subunit C11