PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AHYPO_008186-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Amaranthaceae; Amaranthus
Family LBD
Protein Properties Length: 173aa    MW: 20236.5 Da    PI: 3.8682
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AHYPO_008186-RAgenomeBYUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF26026.22.2e-082394380
           DUF260 43 lkllkalpeeeredamsslvyeAearardPvyGavgvi 80
                     ++ l+++++e ++d+m+sl+y A+ar++dPv+G  + +
  AHYPO_008186-RA  2 TNALRSTDPEFHDDLMTSLIYSANARVKDPVHGGSNDV 39
                     6788999999***********************87655 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031951.4E-5239IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 173 aa     Download sequence    Send to blast
MTNALRSTDP EFHDDLMTSL IYSANARVKD PVHGGSNDVS LYVDDYVVND QQFQNQHFEG  60
QQYIPSFHQP EYENNQYSAI DKDSHPYNYV TETDLFGCTN QESTPSWFPQ PQHDGDTQHR  120
VDNDDVPLSV DDYVVDEAFF VECPDQQFQN QPFENQQYMP SFHQAQYENN NQY