PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AHYPO_006294-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Amaranthaceae; Amaranthus
Family LBD
Protein Properties Length: 167aa    MW: 18313.8 Da    PI: 6.7171
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AHYPO_006294-RAgenomeBYUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF26061.52.3e-193176146
           DUF260  1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkll 46
                     +CaaCk+lrr+C+++Cvlapyfp ++p kf ++h++FGasn+++++
  AHYPO_006294-RA 31 PCAACKILRRRCVDKCVLAPYFPPSEPLKFTIAHRVFGASNIINMV 76
                     7******************************************985 PP

2DUF26042.12.6e-137511461100
           DUF260  61 lvyeAearardPvyGavgvilklqqqleqlkaelallkee 100
                      +vyeA+ar+rdPvyG++g i +lq+q+++l+a+la++++e
  AHYPO_006294-RA  75 MVYEANARIRDPVYGCAGAICQLQKQVNELQAQLAKAQAE 114
                      79**********************************9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089114.00930132IPR004883Lateral organ boundaries, LOB
PfamPF031952.3E-2731112IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 167 aa     Download sequence    Send to blast
MVCSDSVSPS SPSSQVTPTP NSQTATVIVS PCAACKILRR RCVDKCVLAP YFPPSEPLKF  60
TIAHRVFGAS NIINMVYEAN ARIRDPVYGC AGAICQLQKQ VNELQAQLAK AQAELVNMKC  120
QQTNLWALIR MELDHSPPSN TSSQSQSPEH PNSLSNYDCF IDDNNLE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A7e-333012410120LOB family transfactor Ramosa2.1
5ly0_B7e-333012410120LOB family transfactor Ramosa2.1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021746106.16e-76LOB domain-containing protein 1-like
SwissprotQ9LQR02e-52LBD1_ARATH; LOB domain-containing protein 1
SwissprotQ9SK083e-52LBD11_ARATH; LOB domain-containing protein 11
TrEMBLA0A0J8DZV53e-73A0A0J8DZV5_BETVU; Uncharacterized protein
STRINGXP_010666030.15e-74(Beta vulgaris)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07900.13e-44LOB domain-containing protein 1