PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AHYPO_005918-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Amaranthaceae; Amaranthus
Family WOX
Protein Properties Length: 182aa    MW: 21271.1 Da    PI: 8.7384
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AHYPO_005918-RAgenomeBYUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox63.14.2e-2058117357
                      --SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
         Homeobox   3 kRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57 
                      +R+++t+eq++ Le l+ +  r+p+a+++e+++++l    +++ ++V++WFqN++a+ ++
  AHYPO_005918-RA  58 TRWNPTEEQIRMLEMLYTEgMRTPNAQQIEHITEHLrkygKIEGKNVFYWFQNHKARLRQ 117
                      7*****************99*************************************996 PP

2Wus_type_Homeobox115.91.9e-3758119465
  Wus_type_Homeobox   4 tRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65 
                        tRW+Pt+eQi++Le+ly++G+rtPn+++i++it++L++yGkie+kNVfyWFQN+kaR rqkq
    AHYPO_005918-RA  58 TRWNPTEEQIRMLEMLYTEGMRTPNAQQIEHITEHLRKYGKIEGKNVFYWFQNHKARLRQKQ 119
                        8***********************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003893.0E-555122IPR001356Homeobox domain
PfamPF000467.2E-1858117IPR001356Homeobox domain
SuperFamilySSF466894.07E-1258122IPR009057Homeodomain-like
CDDcd000863.49E-458119No hitNo description
Gene3DG3DSA:1.10.10.601.4E-759117IPR009057Homeodomain-like
PROSITE profilePS5007110.23663118IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0001944Biological Processvasculature development
GO:0007165Biological Processsignal transduction
GO:0010067Biological Processprocambium histogenesis
GO:0051301Biological Processcell division
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 182 aa     Download sequence    Send to blast
MCSSSMKVHP FSCGFWDDNH QTMHESQAVL TLGCKRFRPL APKLDATNTN VEIHVGGTRW  60
NPTEEQIRML EMLYTEGMRT PNAQQIEHIT EHLRKYGKIE GKNVFYWFQN HKARLRQKQK  120
RTILGLEESE GQNISPYKRK FRSCTFECSE SEERQKKDNK DEESNKTLQL FPLHPEGLVR  180
S*
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor which may be involved in developmental processes. {ECO:0000250}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021726651.14e-73WUSCHEL-related homeobox 4-like isoform X1
RefseqXP_021726652.13e-73WUSCHEL-related homeobox 4-like isoform X2
SwissprotQ6X7J92e-48WOX4_ARATH; WUSCHEL-related homeobox 4
TrEMBLA0A0K9R3U01e-63A0A0K9R3U0_SPIOL; Uncharacterized protein
STRINGXP_010688717.13e-67(Beta vulgaris)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G46480.11e-50WUSCHEL related homeobox 4
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Dolzblasz A, et al.
    Stem Cell Regulation by Arabidopsis WOX Genes.
    Mol Plant, 2016. 9(7): p. 1028-39
    [PMID:27109605]
  3. Guo X, et al.
    Identification of cyst nematode B-type CLE peptides and modulation of the vascular stem cell pathway for feeding cell formation.
    PLoS Pathog., 2017. 13(2): p. e1006142
    [PMID:28158306]
  4. Denis E, et al.
    WOX14 promotes bioactive gibberellin synthesis and vascular cell differentiation in Arabidopsis.
    Plant J., 2017. 90(3): p. 560-572
    [PMID:28218997]
  5. Kucukoglu M,Nilsson J,Zheng B,Chaabouni S,Nilsson O
    WUSCHEL-RELATED HOMEOBOX4 (WOX4)-like genes regulate cambial cell division activity and secondary growth in Populus trees.
    New Phytol., 2017. 215(2): p. 642-657
    [PMID:28609015]
  6. Yamaguchi YL, et al.
    Root-Knot and Cyst Nematodes Activate Procambium-Associated Genes in Arabidopsis Roots.
    Front Plant Sci, 2017. 8: p. 1195
    [PMID:28747918]