PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AHYPO_004642-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Amaranthaceae; Amaranthus
Family GRAS
Protein Properties Length: 582aa    MW: 64918.1 Da    PI: 6.117
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AHYPO_004642-RAgenomeBYUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS422.14.8e-1292115801373
             GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfs 94 
                      l++lL+ecA a+s++ +   ++l+++ ++++s +g+p+qRl ay+ e+L ar  +s++ +y+al+++e      ++ l++++l++e++P+lkf+
  AHYPO_004642-RA 211 LKKLLVECACALSENRFDDFEKLVEQARKRVSISGEPIQRLGAYMIEGLVARKESSGNCIYRALRCKEPL---GKDLLSYMHLLYEICPYLKFG 301
                      5799*****************************************************************8...9******************** PP

             GRAS  95 hltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrl 186
                      +++aN aI ea  +e+r+HiiDf+i qG+QW++LlqaLa+Rp+g+p +RiTg+++p s+  +  +le++g+rLa + e+ ++p+ef++ v   l
  AHYPO_004642-RA 302 YMAANGAIAEACRNEDRIHIIDFQIAQGTQWLTLLQALAARPGGAPYVRITGIDDPVSQyaRGASLEAVGKRLATLSERYNIPVEFHA-VPVFL 394
                      ********************************************************9999999*************************.7999* PP

             GRAS 187 edleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklprese 280
                       +++ e+L+v+pgE+laVn+ lqlh+++desv+++++rd +L++vksl P+v ++veqe+++n+++Fl+rf+eal+yysa+f+s+++++pr+++
  AHYPO_004642-RA 395 PEVTKEMLDVRPGETLAVNFPLQLHHTPDESVDVNNPRDGLLRMVKSLGPRVTTLVEQESNTNTTPFLTRFIEALSYYSAMFESIDVTMPRDKK 488
                      ********************************************************************************************** PP

             GRAS 281 erikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaW 373
                      eri+vE+++l+++ivn++aceg er+erhe l+kW++r+++aGF+++pls+++++ ++ llr ++ + y++ e++g+++lgWkdr L+s+SaW
  AHYPO_004642-RA 489 ERISVEQHCLAKDIVNIIACEGIERVERHELLGKWKSRFTMAGFQQYPLSSYVNSVIRELLRCYS-EHYTLVEKDGAMLLGWKDRMLISASAW 580
                      *************************************************************9999.66************************* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098565.557185562IPR005202Transcription factor GRAS
PfamPF035141.6E-126211580IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 582 aa     Download sequence    Send to blast
MDSRKIFGYN VTGADTSYMS SQYSPEVPNK IFGPLKFNFK NSPISPFSSH FDCETATTLS  60
DSREHHSSSE SLSGKSPCNS PLETNSYYQR FNSSPSDDSH PGIVPPTASG TSYPRNSDYE  120
ANMKHALQEL ETVLMGDESV GGVSRQNVIS SERLGSSSCN PHGLHGSQFQ STTAVGDSKS  180
EDDNGHHNEK RHNAAMEEEI SPELKNSSID LKKLLVECAC ALSENRFDDF EKLVEQARKR  240
VSISGEPIQR LGAYMIEGLV ARKESSGNCI YRALRCKEPL GKDLLSYMHL LYEICPYLKF  300
GYMAANGAIA EACRNEDRIH IIDFQIAQGT QWLTLLQALA ARPGGAPYVR ITGIDDPVSQ  360
YARGASLEAV GKRLATLSER YNIPVEFHAV PVFLPEVTKE MLDVRPGETL AVNFPLQLHH  420
TPDESVDVNN PRDGLLRMVK SLGPRVTTLV EQESNTNTTP FLTRFIEALS YYSAMFESID  480
VTMPRDKKER ISVEQHCLAK DIVNIIACEG IERVERHELL GKWKSRFTMA GFQQYPLSSY  540
VNSVIRELLR CYSEHYTLVE KDGAMLLGWK DRMLISASAW H*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-5923858130375GRAS family transcription factor containing protein, expressed
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtMay play a regulatory role in the early step of oligosaccharide elicitor response, downstream of the membrane-associated high-affinity chitin-binding protein. {ECO:0000269|PubMed:12591613}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By oligosaccharide elicitor (N-Acetylchitooligosaccharide) extracted from the rice blast fungus (M.grisea) cell wall. Strongest induction by chitin oligomer with greater degree of polymerization (heptamer). By inoculation of M.grisea in rice cell suspension culture. {ECO:0000269|PubMed:12591613}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021725970.10.0chitin-inducible gibberellin-responsive protein 1-like
SwissprotQ69VG10.0CIGR1_ORYSJ; Chitin-inducible gibberellin-responsive protein 1
TrEMBLA0A0K9RKI50.0A0A0K9RKI5_SPIOL; Uncharacterized protein
STRINGXP_010694285.10.0(Beta vulgaris)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G48150.21e-164GRAS family protein
Publications ? help Back to Top
  1. Day RB, et al.
    Two rice GRAS family genes responsive to N -acetylchitooligosaccharide elicitor are induced by phytoactive gibberellins: evidence for cross-talk between elicitor and gibberellin signaling in rice cells.
    Plant Mol. Biol., 2004. 54(2): p. 261-72
    [PMID:15159627]