PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AHYPO_003726-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Amaranthaceae; Amaranthus
Family LBD
Protein Properties Length: 322aa    MW: 34798 Da    PI: 9.0418
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AHYPO_003726-RAgenomeBYUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260133.21e-41591581100
           DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkael 94 
                      +CaaCk+lrr+Ca++C+++pyf  ++p+kfa+vhk+FGasnv+kll ++pe++r da++slvyeA++r+rdPvyG++g i++lqqq++ l+ael
  AHYPO_003726-RA  59 PCAACKLLRRRCAEECPFSPYFSPHEPQKFAAVHKVFGASNVSKLLMEVPENQRADAANSLVYEANIRLRDPVYGCMGAISALQQQIQALQAEL 152
                      7********************************************************************************************* PP

           DUF260  95 allkee 100
                      +ll++e
  AHYPO_003726-RA 153 NLLRAE 158
                      *99987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.6858159IPR004883Lateral organ boundaries, LOB
PfamPF031958.0E-4259156IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 322 aa     Download sequence    Send to blast
EDEIRKRVKR KIDGANENKS MVASSCYDNH LQIASTGRRH LMGVGPTPPP GTTLNTITPC  60
AACKLLRRRC AEECPFSPYF SPHEPQKFAA VHKVFGASNV SKLLMEVPEN QRADAANSLV  120
YEANIRLRDP VYGCMGAISA LQQQIQALQA ELNLLRAEII KFKYRQAANH LISATNNSNN  180
PTINHHHPTN NSNNPTINHH HPTNNSNNPT INHHHPTNNS NNPTINHHHP NNNSLVNSLA  240
ATVIAASMPP QVRSPPHQQP PPPPPQATPP PPAPSVSVVS TPPLSGAASF YTPPSPPALS  300
NTLTNAGFAS ISNEHSVPFL D*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A4e-42521624114LOB family transfactor Ramosa2.1
5ly0_B4e-42521624114LOB family transfactor Ramosa2.1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010685965.11e-100PREDICTED: LOB domain-containing protein 15
TrEMBLA0A0K9RA502e-85A0A0K9RA50_SPIOL; Uncharacterized protein
STRINGXP_010685965.11e-100(Beta vulgaris)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40470.11e-55LOB domain-containing protein 15