PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AHYPO_003445-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Amaranthaceae; Amaranthus
Family GRAS
Protein Properties Length: 387aa    MW: 42498.7 Da    PI: 6.3695
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AHYPO_003445-RAgenomeBYUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS349.84.2e-107173803374
             GRAS   3 elLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlar.svselykalppsetseknsseelaalklfsevsPilkfsh 95 
                      +lLl+cA  +s+g+l++a  lL ++ e +sp g+p  R+aayf+ AL+++++    s  ++ ++  + s ++ ++  + l+ ++ ++P++kfsh
  AHYPO_003445-RA  17 SLLLKCASLISTGNLQAAGDLLPEIFEFSSPFGSPADRVAAYFAHALRSKILFyFLSPPSNPIRNLTLS-SQLKNFHSGLQSYNSLTPFVKFSH 109
                      79*************************************************984455555555555554.456666677788************ PP

             GRAS  96 ltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvak..rle 187
                      +taNqaI ea++g+++vH+iD+di+qGlQWp L++ LasRp++  s+R+Tg+g+    s+e l++tg rLa+fA++lg+pf+fn+l  k  +++
  AHYPO_003445-RA 110 FTANQAIFEAINGHDHVHVIDLDIMQGLQWPGLFHILASRPRKLGSVRVTGFGP----SSELLNQTGYRLAEFAASLGLPFQFNALEGKigEMS 199
                      ******************************************************....9**************************955444888 PP

             GRAS 188 dleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadh.nsesFlerflealeyysalfdsleaklprese 280
                      + el++L vk+gE+++V+++   h l+d s+s++     +Lk++  ++Pk+v++veq+++  +++sFlerf+eal+yysalfd+l ++l++es 
  AHYPO_003445-RA 200 ASELSRLGVKSGEMTVVHCMN--HCLYDISGSISG----TLKVLSAVRPKLVTIVEQDLEAcQTTSFLERFVEALHYYSALFDALGEGLGKESV 287
                      889999**************9..888888999998....*******************9999******************************** PP

             GRAS 281 erikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                      +r++vE++l+g ei+n++a  ++  +    +l +W + l ++GF+p +ls + a+qa+lll +++++gy++ ee+g+l lgWkd pL++++aW+
  AHYPO_003445-RA 288 QRHMVEQQLFGTEIRNILAFDERI-NGGDDRLCQWAHELVRVGFEPFSLSGSPAAQANLLLGMFPWKGYTLMEENGCLRLGWKDLPLLTATAWQ 380
                      ********************9998.777788**************************************************************6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098553.0781360IPR005202Transcription factor GRAS
PfamPF035141.5E-10417380IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0048366Biological Processleaf development
GO:0090610Biological Processbundle sheath cell fate specification
GO:0005634Cellular Componentnucleus
Sequence ? help Back to Top
Protein Sequence    Length: 387 aa     Download sequence    Send to blast
MLGVTSPQSN SSLYFLSLLL KCASLISTGN LQAAGDLLPE IFEFSSPFGS PADRVAAYFA  60
HALRSKILFY FLSPPSNPIR NLTLSSQLKN FHSGLQSYNS LTPFVKFSHF TANQAIFEAI  120
NGHDHVHVID LDIMQGLQWP GLFHILASRP RKLGSVRVTG FGPSSELLNQ TGYRLAEFAA  180
SLGLPFQFNA LEGKIGEMSA SELSRLGVKS GEMTVVHCMN HCLYDISGSI SGTLKVLSAV  240
RPKLVTIVEQ DLEACQTTSF LERFVEALHY YSALFDALGE GLGKESVQRH MVEQQLFGTE  300
IRNILAFDER INGGDDRLCQ WAHELVRVGF EPFSLSGSPA AQANLLLGMF PWKGYTLMEE  360
NGCLRLGWKD LPLLTATAWQ PCEIGN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3h_A1e-1212138124379Protein SCARECROW
5b3h_D1e-1212138124379Protein SCARECROW
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in plant development. {ECO:0000250}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021855794.10.0scarecrow-like protein 23
SwissprotQ9FHZ11e-148SCL23_ARATH; Scarecrow-like protein 23
TrEMBLA0A0K9R6860.0A0A0K9R686_SPIOL; Uncharacterized protein
STRINGXP_010669360.11e-178(Beta vulgaris)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G41920.11e-144GRAS family protein
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Yoon EK, et al.
    Conservation and Diversification of the SHR-SCR-SCL23 Regulatory Network in the Development of the Functional Endodermis in Arabidopsis Shoots.
    Mol Plant, 2016. 9(8): p. 1197-1209
    [PMID:27353361]