PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AHYPO_003276-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Amaranthaceae; Amaranthus
Family GRAS
Protein Properties Length: 1070aa    MW: 118938 Da    PI: 6.1255
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AHYPO_003276-RAgenomeBYUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS374.11.7e-11469710681374
             GRAS    1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilk 92  
                       l++lL +cA+av+++d + a++lL+++++++sp+gd +qRla+y++ +L+arla+++s++ykal++++t+    +++l+a+ l+  ++P+ k
  AHYPO_003276-RA  697 LRTLLSSCAQAVATDDRRTANELLKQIRQHSSPRGDGNQRLAHYLADGLEARLAGTGSQIYKALTSQRTT---AADVLKAYLLYLAACPFRK 785 
                       5789************************************************************999999...9****************** PP

             GRAS   93 fshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlv 182 
                       +s++  N+ I + +++++++HiiDf+i +G+QWp+++q  + R++gpp+++iTg++ p++g   +e++eetg rL+++A+e++vpfe+++ +
  AHYPO_003276-RA  786 LSNFFSNKSIAKQTKKASKIHIIDFGILYGFQWPTFIQRQSMREGGPPKIKITGIDFPQPGfrPAERVEETGCRLENYAQEFRVPFEYRA-I 876 
                       ************************************************************9*****************************.7 PP

             GRAS  183 akrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleak 274 
                       akr++++e+e+++++++E+l+Vn++++l++l+de+vs+es r+ vLk++++l+P ++++   +  ++++ F++rf eal ++sa fd+le+ 
  AHYPO_003276-RA  877 AKRWDTIEPEDFDIDEDEVLIVNCIYRLKNLPDETVSVESSRNIVLKMIRKLNPALFIHGVVNGAYSAPFFVTRFREALFHFSAQFDMLETV 968 
                       ******************************************************************************************** PP

             GRAS  275 lpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrp 366 
                       +pre  er+ +E+ ll+re+ nvvaceg er+er et+++W+ r  +aGF+++pl++++ + a +l++  + + ++++e++ +l+lgWk+r 
  AHYPO_003276-RA  969 VPREYVERMLIEKDLLAREALNVVACEGWERVERPETYKQWKIRTIRAGFTQLPLDSEIKERALMLVHSAYHKDFMIDEDNRWLLLGWKGRV 1060
                       ***********************************************************************888****************** PP

             GRAS  367 LvsvSaWr 374 
                       L+++S W+
  AHYPO_003276-RA 1061 LFALSTWE 1068
                       *******5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:3.40.640.102.5E-323121IPR015421Pyridoxal phosphate-dependent transferase, major region, subdomain 1
SuperFamilySSF533837.01E-936322IPR015424Pyridoxal phosphate-dependent transferase
PfamPF012121.5E-357121IPR001597Aromatic amino acid beta-eliminating lyase/threonine aldolase
PfamPF012122.4E-41123268IPR001597Aromatic amino acid beta-eliminating lyase/threonine aldolase
Gene3DG3DSA:3.40.640.102.6E-32124227IPR015421Pyridoxal phosphate-dependent transferase, major region, subdomain 1
Gene3DG3DSA:3.90.1150.109.8E-24229322IPR015422Pyridoxal phosphate-dependent transferase, major region, subdomain 2
PROSITE profilePS5098566.2026711048IPR005202Transcription factor GRAS
PfamPF035146.0E-1126971068IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006520Biological Processcellular amino acid metabolic process
GO:0016829Molecular Functionlyase activity
Sequence ? help Back to Top
Protein Sequence    Length: 1070 aa     Download sequence    Send to blast
MVKRVIDLRS DTVTKPTEAM RIAMSKAEVD DDVLGYDPTA LRLEAEMARM MGKEGGLFVP  60
SGTMGNLISV LVHCDVRGSE VILGDISHIH VYENGGISTI GGVHPRTVKN NKDGTMDLDL  120
IDSGGRCLSV EYTDQVGELA KKHGLKLHID GARIFNAAIA LGVPVDRLVQ AADSVSVCLS  180
KGLGAPVGTV IVGSKNFIAK AKILRKTLGG GMRQIGILCA AALVAVQDNV RKLGDDHKNA  240
KLLADGLNQI SGLKVDISSV ETNIIYVHVC EKANTTAPKL AKFLEENGIL VMLENTSRFR  300
VVTHHQITTR DVEHTLSCLR AFNDHTFPLC SNNGLVNGLP DLRNELVIMG HDNNINNTGS  360
DISGFNYMFP NDQSAANSNL SSISGVTHEG NLLEDYDFSD SILRYINQIL VEEEVEGKGC  420
MLQESLQHQA LQDAEKSMYE VIGKSYRPQL DSQANMACFS PNFNNPECCF SDDYYRCKFG  480
IGESNNLSVD PDWAYGRDGN WAIGYENACT PYQPLVSSSA VNYAINGGLM DSHLTENLPW  540
GLEMSAESRS ISQFTKGIEE ASKFLPSQSD LFGIAEANGL PERFKESSVN PGVNKDEDDI  600
RDENRVRKHA VADNLDTEEE RTAKLAAVFD DSNVRSDMFD QVLLHHGGDK NELVASLRTT  660
LQTAAIMKTE QSVQSKGSVG GKGRGKKHGG RKEVVDLRTL LSSCAQAVAT DDRRTANELL  720
KQIRQHSSPR GDGNQRLAHY LADGLEARLA GTGSQIYKAL TSQRTTAADV LKAYLLYLAA  780
CPFRKLSNFF SNKSIAKQTK KASKIHIIDF GILYGFQWPT FIQRQSMREG GPPKIKITGI  840
DFPQPGFRPA ERVEETGCRL ENYAQEFRVP FEYRAIAKRW DTIEPEDFDI DEDEVLIVNC  900
IYRLKNLPDE TVSVESSRNI VLKMIRKLNP ALFIHGVVNG AYSAPFFVTR FREALFHFSA  960
QFDMLETVVP REYVERMLIE KDLLAREALN VVACEGWERV ERPETYKQWK IRTIRAGFTQ  1020
LPLDSEIKER ALMLVHSAYH KDFMIDEDNR WLLLGWKGRV LFALSTWEPT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3wgb_A4e-8343225338L-allo-threonine aldolase
3wgb_B4e-8343225338L-allo-threonine aldolase
3wgb_C4e-8343225338L-allo-threonine aldolase
3wgb_D4e-8343225338L-allo-threonine aldolase
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in plant development. {ECO:0000250}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021856937.10.0scarecrow-like protein 9
SwissprotO809330.0SCL9_ARATH; Scarecrow-like protein 9
TrEMBLA0A0K9QXM30.0A0A0K9QXM3_SPIOL; Uncharacterized protein
STRINGXP_006480839.10.0(Citrus sinensis)
STRINGXP_006429104.10.0(Citrus clementina)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37650.10.0GRAS family protein