PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AHYPO_002676-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Amaranthaceae; Amaranthus
Family WOX
Protein Properties Length: 280aa    MW: 30051.4 Da    PI: 6.1211
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AHYPO_002676-RAgenomeBYUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox49.19.8e-163898257
                     T--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
         Homeobox  2 rkRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57
                     r+R+t+++eq+ +Le+ F++   +p +ee  ++ k l     + +++V++WFqNrR + ++
  AHYPO_002676-RA 38 RSRWTPKPEQILILESIFNSgMVNPPKEETIRIRKLLekfgAVGDANVFYWFQNRRSRSRR 98
                     89*****************99*************************************997 PP

2Wus_type_Homeobox106.41.7e-3437100265
  Wus_type_Homeobox   2 artRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65 
                        +r+RWtP+peQi iLe++++sG+++P+kee+ ri++ Le++G+++d+NVfyWFQNr++R+r++q
    AHYPO_002676-RA  37 VRSRWTPKPEQILILESIFNSGMVNPPKEETIRIRKLLEKFGAVGDANVFYWFQNRRSRSRRRQ 100
                        589***********************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.1E-91499IPR009057Homeodomain-like
SuperFamilySSF466894.71E-1432105IPR009057Homeodomain-like
PROSITE profilePS5007111.5153499IPR001356Homeobox domain
SMARTSM003891.2E-636103IPR001356Homeobox domain
PfamPF000461.6E-133898IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0048830Biological Processadventitious root development
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 280 aa     Download sequence    Send to blast
MEDPSPNKKN NNTESENSSN TKEEKKNNNN STNSEPVRSR WTPKPEQILI LESIFNSGMV  60
NPPKEETIRI RKLLEKFGAV GDANVFYWFQ NRRSRSRRRQ RQLQASLAAT AASPPLVPPP  120
LLGGSGGCGG GSGVNLLYEL SQNQQQNSSV TTTIGGCSSS VGCFAPCSSV TSISNTNSFG  180
DCGGVDDVFG TFSGIINTTH QLDCHSQGSN LDFQSGLITV FINGVATQVP EGVLDMRSMF  240
GEEVILVHSS GAPVPFNDFG ISLQSLQHGE SYFLVPRLS*
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor which may be involved in developmental processes. {ECO:0000250}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021728368.12e-97WUSCHEL-related homeobox 11-like
SwissprotQ6X7J38e-62WOX11_ARATH; WUSCHEL-related homeobox 11
TrEMBLA0A2R6RA154e-69A0A2R6RA15_ACTCH; WUSCHEL-related homeobox like
STRINGXP_010677789.12e-92(Beta vulgaris)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G03660.17e-34WUSCHEL related homeobox 11
Publications ? help Back to Top
  1. Hu X,Xu L
    Transcription Factors WOX11/12 Directly Activate WOX5/7 to Promote Root Primordia Initiation and Organogenesis.
    Plant Physiol., 2016. 172(4): p. 2363-2373
    [PMID:27784768]
  2. Sheng L, et al.
    Non-canonical WOX11-mediated root branching contributes to plasticity in Arabidopsis root system architecture.
    Development, 2017. 144(17): p. 3126-3133
    [PMID:28743799]
  3. Liu J, et al.
    The WOX11-LBD16 Pathway Promotes Pluripotency Acquisition in Callus Cells During De Novo Shoot Regeneration in Tissue Culture.
    Plant Cell Physiol., 2018. 59(4): p. 734-743
    [PMID:29361138]
  4. Baesso B, et al.
    Transcription factors PRE3 and WOX11 are involved in the formation of new lateral roots from secondary growth taproot in A. thaliana.
    Plant Biol (Stuttg), 2018. 20(3): p. 426-432
    [PMID:29450949]