PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AHYPO_002609-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Amaranthaceae; Amaranthus
Family GRAS
Protein Properties Length: 547aa    MW: 61302.7 Da    PI: 4.7368
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AHYPO_002609-RAgenomeBYUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS4163.3e-1271765462374
             GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfsh 95 
                      +elL++cA  +s+gd+e+a   +++l++++s +g+p qR+aay++e+Laarla+s++ lykal+++e +   s e+laa+++++ev+P++kf++
  AHYPO_002609-RA 176 KELLFDCAAIISEGDFEEAALRINKLRQMVSIQGEPSQRIAAYMVEGLAARLASSGKVLYKALRCKEPP---SFEKLAAMQVLFEVCPCFKFGF 266
                      589*****************************************************************9...9********************* PP

             GRAS  96 ltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrle 187
                      ++aN+aI+ea++ +++vHiiDfdi+qG Q+++L+++La++++++ ++R+Tgv++pes+      l+++g+rL+ +Ae  +++fef++ + +r+ 
  AHYPO_002609-RA 267 MAANEAIMEAIKYDKKVHIIDFDINQGNQYINLIRSLAKQRGKSIQVRLTGVDDPESVqrPIGGLKNIGQRLEALAEINELQFEFKA-IPSRTP 359
                      ********************************************************99888899***********************.7***** PP

             GRAS 188 dleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpresee 281
                       +++e+L+++ gEal+Vn+++ lh+l+desvs+ + rd++L+++ksl+Pk+v+vveq++++n+++Fl rf+e  +yysa+f+sl+a+lpres+e
  AHYPO_002609-RA 360 LVTPEMLDCRAGEALVVNFAFLLHHLPDESVSTVNIRDQLLRMIKSLNPKLVTVVEQDVNTNTTPFLSRFSEVYSYYSAVFESLDATLPRESQE 453
                      ********************************************************************************************** PP

             GRAS 282 rikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                      ri+vE+++l+r+ivn++aceg+er+er e ++kWr+r+++aGF++ pl++++++ ++ l+   + + y+++   ++l +gW+d++Lv++SaW+
  AHYPO_002609-RA 454 RINVEKQCLARDIVNIIACEGEERIERYEVAGKWRARMQMAGFRSCPLKQNVNEMIRELIVSQYCNKYKLNVMMDALHFGWEDKSLVVASAWK 546
                      ************************************************************9999888*************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098560.407149526IPR005202Transcription factor GRAS
PfamPF035141.1E-124176546IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 547 aa     Download sequence    Send to blast
MSTTYGSPRL CALQGGNNSS GLSNQLYGSE KHKIKYATES FSSPSYCYDP KFFVNSPSGE  60
LINPPSAAGN QFDSSCATNY ELEYFISQSP EAVEYDEGMV KLKLQELEHA LLDEEEDGVD  120
EVVMGPETSM EIDVDWAGSL RNMMDHDSPK ESTSSESSNL SSISNKDESL PLRSTKELLF  180
DCAAIISEGD FEEAALRINK LRQMVSIQGE PSQRIAAYMV EGLAARLASS GKVLYKALRC  240
KEPPSFEKLA AMQVLFEVCP CFKFGFMAAN EAIMEAIKYD KKVHIIDFDI NQGNQYINLI  300
RSLAKQRGKS IQVRLTGVDD PESVQRPIGG LKNIGQRLEA LAEINELQFE FKAIPSRTPL  360
VTPEMLDCRA GEALVVNFAF LLHHLPDESV STVNIRDQLL RMIKSLNPKL VTVVEQDVNT  420
NTTPFLSRFS EVYSYYSAVF ESLDATLPRE SQERINVEKQ CLARDIVNII ACEGEERIER  480
YEVAGKWRAR MQMAGFRSCP LKQNVNEMIR ELIVSQYCNK YKLNVMMDAL HFGWEDKSLV  540
VASAWK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3h_A3e-5718254525377Protein SCARECROW
5b3h_D3e-5718254525377Protein SCARECROW
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in plant development. {ECO:0000250}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021771709.10.0scarecrow-like protein 1
SwissprotQ9SDQ30.0SCL1_ARATH; Scarecrow-like protein 1
TrEMBLA0A0J8BFG00.0A0A0J8BFG0_BETVU; Uncharacterized protein
STRINGXP_010692620.10.0(Beta vulgaris)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G21450.10.0SCARECROW-like 1
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]