PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AHYPO_002505-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Amaranthaceae; Amaranthus
Family GRAS
Protein Properties Length: 456aa    MW: 50866.4 Da    PI: 6.4429
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AHYPO_002505-RAgenomeBYUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS4692.6e-143474521374
             GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfs 94 
                      l++lLl+cA++vs+g+l +a+ +L+++s+laspdgd+mqR+aayf+e La+r+++s+++l++al+ ++ +   +see+ a+klf+e++P+lk++
  AHYPO_002505-RA  47 LIHLLLSCANHVSTGNLDNANLALEQISHLASPDGDTMQRIAAYFAESLAERVLKSWPGLFRALNFTRMP--VVSEEILARKLFFELFPFLKLA 138
                      689***************************************************************9999..6********************* PP

             GRAS  95 hltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrled 188
                      ++++Nq Ilea+ege++vHiiD+++s+++QW+aL+qaL++Rpegpp+lRiTgv++    +ke l ++++rL++ Ae+l++pf+fn+ v+++le+
  AHYPO_002505-RA 139 FVVTNQSILEAMEGEKMVHIIDLNASEPAQWIALIQALSARPEGPPHLRITGVHQ----QKEVLDKVAHRLTEEAEKLDLPFQFNP-VVSKLEN 227
                      *******************************************************....9**************************.799**** PP

             GRAS 189 leleeLrvkpgEalaVnlvlqlhrll.......................................desvsles..erdevLklvkslsPkvvvv 241
                      l++e+Lrvk+gEala+++vlqlh+ll                                          +s++   + d +L  +++lsPk++v+
  AHYPO_002505-RA 228 LDVEKLRVKTGEALAISSVLQLHTLLacdddslrkinslallnhmngvgngntrsspsndsasssP--TSINAstKMDGFLASLWGLSPKIMVI 319
                      ************************************************************998553..33333447899*************** PP

             GRAS 242 veqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaak 335
                      +eq+++hn+  ++er++eal++y+alfd+le++++r s er+kvE++llg+ei+n++aceg errerhe+lekW +rl+++GF+++pls+  + 
  AHYPO_002505-RA 320 TEQDSNHNGLGLMERLSEALYFYAALFDCLESTASRSSPERRKVEKMLLGEEIKNIIACEGGERRERHEKLEKWMQRLDMVGFGSIPLSYMGML 413
                      ********************************************************************************************** PP

             GRAS 336 qaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                      qa++ll+  + dgyr++ee+g++v++W+drpL+svSaWr
  AHYPO_002505-RA 414 QARRLLQGSNCDGYRIKEENGCVVICWQDRPLFSVSAWR 452
                      **************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098559.98421432IPR005202Transcription factor GRAS
PfamPF035148.9E-14147452IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009739Biological Processresponse to gibberellin
GO:0005634Cellular Componentnucleus
Sequence ? help Back to Top
Protein Sequence    Length: 456 aa     Download sequence    Send to blast
MGPMLQDDGS SVTSSSPLQF FSRMSPNLGS PNPWLRELKP EERGLYLIHL LLSCANHVST  60
GNLDNANLAL EQISHLASPD GDTMQRIAAY FAESLAERVL KSWPGLFRAL NFTRMPVVSE  120
EILARKLFFE LFPFLKLAFV VTNQSILEAM EGEKMVHIID LNASEPAQWI ALIQALSARP  180
EGPPHLRITG VHQQKEVLDK VAHRLTEEAE KLDLPFQFNP VVSKLENLDV EKLRVKTGEA  240
LAISSVLQLH TLLACDDDSL RKINSLALLN HMNGVGNGNT RSSPSNDSAS SSPTSINAST  300
KMDGFLASLW GLSPKIMVIT EQDSNHNGLG LMERLSEALY FYAALFDCLE STASRSSPER  360
RKVEKMLLGE EIKNIIACEG GERRERHEKL EKWMQRLDMV GFGSIPLSYM GMLQARRLLQ  420
GSNCDGYRIK EENGCVVICW QDRPLFSVSA WRCRR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3h_A9e-73314542380Protein SCARECROW
5b3h_D9e-73314542380Protein SCARECROW
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in plant development. {ECO:0000250}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021751490.10.0scarecrow-like protein 3
SwissprotQ9LPR80.0SCL3_ARATH; Scarecrow-like protein 3
TrEMBLA0A0K9RSV50.0A0A0K9RSV5_SPIOL; Uncharacterized protein
STRINGXP_010673719.10.0(Beta vulgaris)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G50420.10.0scarecrow-like 3
Publications ? help Back to Top
  1. Gong X, et al.
    SEUSS Integrates Gibberellin Signaling with Transcriptional Inputs from the SHR-SCR-SCL3 Module to Regulate Middle Cortex Formation in the Arabidopsis Root.
    Plant Physiol., 2016. 170(3): p. 1675-83
    [PMID:26818732]
  2. Lee SA, et al.
    Interplay between ABA and GA Modulates the Timing of Asymmetric Cell Divisions in the Arabidopsis Root Ground Tissue.
    Mol Plant, 2016. 9(6): p. 870-84
    [PMID:26970019]
  3. Choi JW,Lim J
    Control of Asymmetric Cell Divisions during Root Ground Tissue Maturation.
    Mol. Cells, 2016. 39(7): p. 524-9
    [PMID:27306644]