PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AHYPO_002483-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Amaranthaceae; Amaranthus
Family NF-YA
Protein Properties Length: 304aa    MW: 33047.4 Da    PI: 7.2423
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AHYPO_002483-RAgenomeBYUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA102.54.1e-32176232158
        CBFB_NFYA   1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                      +ep+YVNaKQy++Il+RRq Rak+e e+kl +ksrkpylheSRh+hAlrR+Rg+gGrF
  AHYPO_002483-RA 176 QEPVYVNAKQYHGILRRRQVRAKAELERKL-IKSRKPYLHESRHQHALRRARGTGGRF 232
                      69****************************.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005211.2E-35174235IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115237.559175235IPR001289Nuclear transcription factor Y subunit A
PfamPF020453.2E-27177232IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006162.9E-24178200IPR001289Nuclear transcription factor Y subunit A
PROSITE patternPS006860180200IPR018362CCAAT-binding factor, conserved site
PRINTSPR006162.9E-24209232IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010262Biological Processsomatic embryogenesis
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0055046Biological Processmicrogametogenesis
GO:0016602Cellular ComponentCCAAT-binding factor complex
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 304 aa     Download sequence    Send to blast
MPLKSISTYQ AVPSTNTTTN TPSAVCSEQW WRAAQPTPLP LSDAGVDAPK HTLLNHPAKM  60
SGSKDEQSLS NPGDDDETSK DSETTGSTST PRDGSSGHEL QKSQYGESSM TLGSGDYFAQ  120
HPQLDLVGHS MACGSTPYPD LYYGGMMAAY GPQALVPPQF YGMHQPRMPL PLEMAQEPVY  180
VNAKQYHGIL RRRQVRAKAE LERKLIKSRK PYLHESRHQH ALRRARGTGG RFAKKGENEG  240
SGHSAEERSK ASDTGEVHSH ENSVEHNDIS NGSGETRAKE GQSNQQWGSS MSTDKAPQFA  300
LAI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A4e-19176232258NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010673645.11e-176PREDICTED: nuclear transcription factor Y subunit A-1-like
SwissprotQ945M91e-55NFYA9_ARATH; Nuclear transcription factor Y subunit A-9
TrEMBLA0A0J8CLA31e-176A0A0J8CLA3_BETVU; Uncharacterized protein
STRINGGLYMA18G07890.28e-79(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G20910.16e-56nuclear factor Y, subunit A9