PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AHYPO_002392-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Amaranthaceae; Amaranthus
Family CAMTA
Protein Properties Length: 990aa    MW: 110234 Da    PI: 5.3877
Description CAMTA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AHYPO_002392-RAgenomeBYUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CG-1181.59.8e-57211363118
             CG-1   3 kekkrwlkneeiaaiLenfekheltlelktrpksgsliLynrkkvryfrkDGyswkkkkdgktvrEdhekLKvggvevlycyYahseenptfqr 96 
                      + ++rwl++ ei++iL n+ k+++++e+++rp+sgsl+L++rk++ryfrkDG++w+kkkdgktv+E+hekLKvg+v+vl+cyYah+e+n+ fqr
  AHYPO_002392-RA  21 EAQHRWLRPAEICEILRNYPKFQISSEPPNRPSSGSLFLFDRKVLRYFRKDGHNWRKKKDGKTVKEAHEKLKVGSVDVLHCYYAHGEDNEFFQR 114
                      349******************************************************************************************* PP

             CG-1  97 rcywlLeeelekivlvhylevk 118
                      r+ywlLeee+ +iv+vhylevk
  AHYPO_002392-RA 115 RSYWLLEEEFMHIVFVHYLEVK 136
                      *******************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5143782.65915141IPR005559CG-1 DNA-binding domain
SMARTSM010761.5E-8018136IPR005559CG-1 DNA-binding domain
PfamPF038593.4E-5021135IPR005559CG-1 DNA-binding domain
Gene3DG3DSA:2.60.40.101.4E-7419508IPR013783Immunoglobulin-like fold
SuperFamilySSF812961.04E-16422507IPR014756Immunoglobulin E-set
CDDcd001029.49E-4422508No hitNo description
PfamPF018331.4E-7422507IPR002909IPT domain
Gene3DG3DSA:1.25.40.201.9E-14579700IPR020683Ankyrin repeat-containing domain
PROSITE profilePS5029712.673592707IPR020683Ankyrin repeat-containing domain
CDDcd002043.27E-9592695No hitNo description
SuperFamilySSF484031.9E-13594700IPR020683Ankyrin repeat-containing domain
SuperFamilySSF525403.72E-8802855IPR027417P-loop containing nucleoside triphosphate hydrolase
SMARTSM000150.027804826IPR000048IQ motif, EF-hand binding site
PROSITE profilePS500968.974805834IPR000048IQ motif, EF-hand binding site
PfamPF006125.4E-4806825IPR000048IQ motif, EF-hand binding site
SMARTSM000150.0012827849IPR000048IQ motif, EF-hand binding site
PROSITE profilePS500969.56828852IPR000048IQ motif, EF-hand binding site
PfamPF006126.4E-5831849IPR000048IQ motif, EF-hand binding site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 990 aa     Download sequence    Send to blast
MADRGSINPG IRLDIQQLQL EAQHRWLRPA EICEILRNYP KFQISSEPPN RPSSGSLFLF  60
DRKVLRYFRK DGHNWRKKKD GKTVKEAHEK LKVGSVDVLH CYYAHGEDNE FFQRRSYWLL  120
EEEFMHIVFV HYLEVKGNRN NVRGTEPVIS TSQISNSMSS SVSNSYNDAF TGNAGSPSAV  180
SSLTSSYDDF ESEDNHQAMS KYPSLNFSPV EDRYENNKMG PLLSSNYLQA FPEEYNGVQP  240
LDYVSLVQQD LGTNDDNQFK TLDLASWEEV FQQSTRGPGN LQVNPLISAA PLVGSTGDYN  300
ENISQFSDAG LGFNAVAGGS LTPYIPSINP LELSSTEFQD NTNVSCTAKQ PLLGNIIAGE  360
GLQKVDSFSK WMSKELAGVD LDLKPSSEFS WIVSTASVDD PSEPGEDYSM SPSIGQDQLF  420
DIQDFSPSCS STDTETKVVI TGKFLVSPSE VSKYNWSCMF GEVEVPALVL GNGVLCCRAP  480
LHKAGRVPFY VTCSNRFACS QLREFEYIVD SEKAKSMNVS GNSMTEEQLW IRLHELLSLK  540
SPGNFNSTSE SFRKKEPVFK KILLSMEDEL CLGVEQQLKE KVVSWLFDKV NEDGKGPNVL  600
DEKGQGLIHL AAALGLDWII PPTVAAGVSV NFRDICGWTA LHWAAFCGRE TSVALLVALE  660
AASGAVTDPS PEFPLGRTAA DLASANGFKG ISGFLAEHSL TAHLETLTMT EDSISKAVQT  720
MREKVATPGN EGDGSDLSLK DSLAAVRNAT QAAGRIHQVF RMQSFQRKHV SKGGAPADDD  780
LFNDEQFLSL LSSKIQRPGH PDEQAHSAAV RIQKKFRGYK KRKEFLIIRE RVVKIQAHVR  840
GHQVRKRYKT VVWSVGILEK VILRWRRRGT GLRGFRPDAL NKASSTQEAQ DVQKNPSEDD  900
DYDYLKEGRK QTEERLQKAL VRVKSMVQYP EGRAQYRRLL TAVEGFQKNQ QVHGSVLDSS  960
EDLPVEGEED MIDVESLLDD DNFMAIAFE*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010690492.10.0PREDICTED: calmodulin-binding transcription activator 2 isoform X2
SwissprotQ6NPP40.0CMTA2_ARATH; Calmodulin-binding transcription activator 2
TrEMBLA0A0J8EEU30.0A0A0J8EEU3_BETVU; Uncharacterized protein
STRINGGLYMA08G07680.20.0(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G09410.10.0ethylene induced calmodulin binding protein