PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AHYPO_001826-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Amaranthaceae; Amaranthus
Family LBD
Protein Properties Length: 191aa    MW: 20742.7 Da    PI: 6.4799
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AHYPO_001826-RAgenomeBYUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260137.74.2e-43291281100
           DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkael 94 
                      +CaaCk+lrr+Ca++Cvlapyfp ++p kf ++h++FGasn++k+l++lpe++r da+ss+vyeA+ar+rdPvyG++g i +lq+q+++l+a+l
  AHYPO_001826-RA  29 PCAACKILRRRCADKCVLAPYFPPTEPLKFTIAHRVFGASNIIKFLQELPESQRADAVSSMVYEANARIRDPVYGCAGAICQLQKQVNELQAQL 122
                      7********************************************************************************************* PP

           DUF260  95 allkee 100
                      a++++e
  AHYPO_001826-RA 123 AKVQAE 128
                      **9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.26628129IPR004883Lateral organ boundaries, LOB
PfamPF031954.7E-4329126IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005739Cellular Componentmitochondrion
Sequence ? help Back to Top
Protein Sequence    Length: 191 aa     Download sequence    Send to blast
MVCNDSISPS FSSQITPPDS QPTAVVISPC AACKILRRRC ADKCVLAPYF PPTEPLKFTI  60
AHRVFGASNI IKFLQELPES QRADAVSSMV YEANARIRDP VYGCAGAICQ LQKQVNELQA  120
QLAKVQAELV NMKCQQANLL AFVCMEMAHS PTSNASSQSQ SPEHPNSSSN HACFIDDNNL  180
GGTLWEPLWT *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A3e-432813610118LOB family transfactor Ramosa2.1
5ly0_B3e-432813610118LOB family transfactor Ramosa2.1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021746106.11e-103LOB domain-containing protein 1-like
SwissprotQ9LQR07e-73LBD1_ARATH; LOB domain-containing protein 1
SwissprotQ9SK082e-72LBD11_ARATH; LOB domain-containing protein 11
TrEMBLA0A0J8DZV51e-101A0A0J8DZV5_BETVU; Uncharacterized protein
STRINGXP_010666030.11e-101(Beta vulgaris)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07900.13e-73LOB domain-containing protein 1