PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AHYPO_001076-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Amaranthaceae; Amaranthus
Family NF-YB
Protein Properties Length: 177aa    MW: 19170.3 Da    PI: 7.0578
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AHYPO_001076-RAgenomeBYUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB180.21.8e-5625119195
            NF-YB   1 vreqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrele 94 
                      vreqdr+lPian+srimkk+lPan+ki+kdaketvqecvsefisf+tseasdkcqrekrktingddllwa+atlGfedy+eplk+yl++yre +
  AHYPO_001076-RA  25 VREQDRYLPIANISRIMKKALPANGKIAKDAKETVQECVSEFISFITSEASDKCQREKRKTINGDDLLWAMATLGFEDYIEPLKIYLTRYREGD 118
                      69*****************************************************************************************966 PP

            NF-YB  95 g 95 
                      +
  AHYPO_001076-RA 119 T 119
                      5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.101.6E-5422140IPR009072Histone-fold
SuperFamilySSF471132.99E-4028152IPR009072Histone-fold
PfamPF008083.5E-283195IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006152.9E-215977No hitNo description
PROSITE patternPS0068506278IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006152.9E-217896No hitNo description
PRINTSPR006152.9E-2197115No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 177 aa     Download sequence    Send to blast
MADAPSSPGG GSHESGGDHS PRSNVREQDR YLPIANISRI MKKALPANGK IAKDAKETVQ  60
ECVSEFISFI TSEASDKCQR EKRKTINGDD LLWAMATLGF EDYIEPLKIY LTRYREGDTK  120
GSAKGGESSG KRDTMGGQSA PNVQLAHQGS FNQSHQVLNY GNSQAQHLMV QMPGPE*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1n1j_A1e-4824116193NF-YB
4awl_B1e-4824116294NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
4csr_A1e-4824116294NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
4g91_B1e-4825116192Transcription factor HapC (Eurofung)
4g92_B1e-4825116192Transcription factor HapC (Eurofung)
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtComponent of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010667231.11e-109PREDICTED: nuclear transcription factor Y subunit B-10
SwissprotQ8VYK42e-86NFYB8_ARATH; Nuclear transcription factor Y subunit B-8
TrEMBLA0A0K9QEG31e-104A0A0K9QEG3_SPIOL; Uncharacterized protein
STRINGXP_010667231.11e-109(Beta vulgaris)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G53340.19e-75nuclear factor Y, subunit B10
Publications ? help Back to Top
  1. Zhao H, et al.
    The Arabidopsis thaliana Nuclear Factor Y Transcription Factors.
    Front Plant Sci, 2016. 7: p. 2045
    [PMID:28119722]