PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AHYPO_000301-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Amaranthaceae; Amaranthus
Family CAMTA
Protein Properties Length: 889aa    MW: 98522.6 Da    PI: 6.269
Description CAMTA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AHYPO_000301-RAgenomeBYUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CG-11742e-54131263116
             CG-1   3 kekkrwlkneeiaaiLenfekheltlelktrpksgsliLynrkkvryfrkDGyswkkkkdgktvrEdhekLKvggvevlycyYahseenptfqr 96 
                        ++rwlk+ e+  iL+n++++++t+e++++p+sgsl+L+n++++r+frkDG+sw+kkkdg+tv E+he+LKvg+ e+l+cyYah+e+np+fqr
  AHYPO_000301-RA  13 AAHTRWLKPAEVFFILQNHANYKITQEAPQKPPSGSLFLFNKRVLRFFRKDGHSWRKKKDGRTVGEAHERLKVGNAEALNCYYAHGEINPNFQR 106
                      3489****************************************************************************************** PP

             CG-1  97 rcywlLeeelekivlvhyle 116
                      r+yw+L+  +e+ivlvhy+e
  AHYPO_000301-RA 107 RSYWMLDPVYEHIVLVHYRE 126
                      ******************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5143779.8087133IPR005559CG-1 DNA-binding domain
SMARTSM010763.0E-7410128IPR005559CG-1 DNA-binding domain
PfamPF038599.8E-4814126IPR005559CG-1 DNA-binding domain
Gene3DG3DSA:2.60.40.104.6E-8321408IPR013783Immunoglobulin-like fold
SuperFamilySSF812963.89E-17323407IPR014756Immunoglobulin E-set
CDDcd001021.45E-5323408No hitNo description
PfamPF018338.4E-9323406IPR002909IPT domain
PROSITE profilePS5029714.292515607IPR020683Ankyrin repeat-containing domain
Gene3DG3DSA:1.25.40.207.0E-13516607IPR020683Ankyrin repeat-containing domain
SuperFamilySSF484031.24E-13519609IPR020683Ankyrin repeat-containing domain
CDDcd002041.50E-11520607No hitNo description
PfamPF127964.5E-7534608IPR020683Ankyrin repeat-containing domain
SMARTSM002485.5E-4548577IPR002110Ankyrin repeat
PROSITE profilePS5008810.686548580IPR002110Ankyrin repeat
SMARTSM00248950587616IPR002110Ankyrin repeat
SMARTSM0001561665687IPR000048IQ motif, EF-hand binding site
PROSITE profilePS500967.199666695IPR000048IQ motif, EF-hand binding site
SuperFamilySSF525402.2E-7718777IPR027417P-loop containing nucleoside triphosphate hydrolase
SMARTSM000150.005725747IPR000048IQ motif, EF-hand binding site
PROSITE profilePS500968.334726755IPR000048IQ motif, EF-hand binding site
PfamPF006120.0017727746IPR000048IQ motif, EF-hand binding site
SMARTSM000152.7E-4748770IPR000048IQ motif, EF-hand binding site
PROSITE profilePS500969.048749773IPR000048IQ motif, EF-hand binding site
PfamPF006125.5E-5751770IPR000048IQ motif, EF-hand binding site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 889 aa     Download sequence    Send to blast
MQSGFDINEL LQAAHTRWLK PAEVFFILQN HANYKITQEA PQKPPSGSLF LFNKRVLRFF  60
RKDGHSWRKK KDGRTVGEAH ERLKVGNAEA LNCYYAHGEI NPNFQRRSYW MLDPVYEHIV  120
LVHYREITEG RLSFGPIAEL SPGASLTFSQ SPSAYTIQNS ESSSLSDIYE SYQSHSSPSS  180
IEVNSDAAMG KGIGCINGSN VTGNSSAASN FDQCLRRLEV QLSLDDDDSL KKYAPVDGQD  240
GSEDILTLDD LYGSSYTGEL TFSDDPSHQQ DSGTGAYKEM NTLSSSTTYS ATPELSTMFL  300
DPSFRMFLGT GSGLTVPKEQ KFTIREICPE WGFADDSTKV IIIGSFLCDP SDSEWFCMFG  360
DAEVPLQFVQ NGVLSCQSPP HPSGKVTLCI SSGNRESCSE IREFEYRDKH STSVNSDKQG  420
ETKRSAEEML LLVRLVRMLL SNSPLQGGNN SLGTDIPQCN DDLWNQIIEN LLVGGATSIS  480
TLDWLLQQLL KDKLQHWLSS RSMERGPGDC FLSRKEQGII HMISGLGYEW ALNPVLACGV  540
GINFRDINGW TALHWAAKFG REKMVAALIA SGASAVALTD PSSHDPTGRN AAYIAAKYGN  600
MGLAGYLSEL ALTSHLSSLT LEQSELSKDT ADVEAESTVI NISKKNVNSA EDQLTLKQTL  660
AAVRNTAQAA ARIQAAFRAH SFRKRQFRGA ACSRADSELD DYGFTINDIP GLSAASKLMF  720
HNMHDHHKAA LSIQKNYRGW KGRKDFLTLR QKVVKIQAHV RGYQVRKQYK VICWAVGILD  780
KVVLRWRRKG AGLRGFRSES DSIDEDDDDI IKDFRKEKVN VAIDEAVTRV LSMAESAEAR  840
QQYHRMLGRT LEAKAELQGI TSSGATVFRD GVSYMDNDDI PTFLESLD*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1421428TKRSAEEM
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006484135.10.0PREDICTED: calmodulin-binding transcription activator 4 isoform X3
SwissprotQ9FYG20.0CMTA4_ARATH; Calmodulin-binding transcription activator 4
TrEMBLA0A0K9QIH30.0A0A0K9QIH3_SPIOL; Uncharacterized protein
STRINGPOPTR_0003s16910.10.0(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G67310.11e-151Calmodulin-binding transcription activator protein with CG-1 and Ankyrin domains