PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araha.9570s0009.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family NAC
Protein Properties Length: 317aa    MW: 35976.2 Da    PI: 6.5191
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araha.9570s0009.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM179.68.2e-5651311129
                  NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdk 90 
                          lppGfrFhPtdeel+++yL++kv++  ++  +++ +vd++k+ePwdLp+k++ +ekewyfFs+rd+ky+tg r+nrat++gyWk+tgkdk
  Araha.9570s0009.1.p   5 LPPGFRFHPTDEELITHYLCRKVSDIGFTG-KAVVDVDLNKCEPWDLPAKASMGEKEWYFFSQRDRKYPTGLRTNRATEAGYWKTTGKDK 93 
                          79*************************999.88***************999999************************************ PP

                  NAM  91 evlskkgelvglkktLvfykgrapkgektdWvmheyrle 129
                          e+++ +g lvg+kktLvfykgrapkgek++Wvmheyrle
  Araha.9570s0009.1.p  94 EIYR-SGVLVGMKKTLVFYKGRAPKGEKSNWVMHEYRLE 131
                          ****.999*****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.4E-643152IPR003441NAC domain
PROSITE profilePS5100560.5575152IPR003441NAC domain
PfamPF023651.7E-296130IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 317 aa     Download sequence    Send to blast
MEENLPPGFR FHPTDEELIT HYLCRKVSDI GFTGKAVVDV DLNKCEPWDL PAKASMGEKE  60
WYFFSQRDRK YPTGLRTNRA TEAGYWKTTG KDKEIYRSGV LVGMKKTLVF YKGRAPKGEK  120
SNWVMHEYRL ESKQPFNPTN KEEWVVCRVF EKSTAAKKAQ EQQPQSSQPS FGSPCDANSS  180
MANEFEDIDE LPNLNSNSST IDYNNHIHQY SQRNVYSEDN TTSTAGLNMN MNMNMASTNL  240
PSWTTSLLGQ PLSPINSLLL KAFQIRNSYS FPKEMIPSFN HSSLQQGVSN MIQNGSSSSQ  300
VQPQPQEEAF NMDSIW*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A1e-60415816171NO APICAL MERISTEM PROTEIN
1ut4_B1e-60415816171NO APICAL MERISTEM PROTEIN
1ut7_A1e-60415816171NO APICAL MERISTEM PROTEIN
1ut7_B1e-60415816171NO APICAL MERISTEM PROTEIN
4dul_A1e-60415816171NAC domain-containing protein 19
4dul_B1e-60415816171NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtBinds to the promoter regions of genes involved in chlorophyll catabolic processes, such as NYC1, SGR1, SGR2 and PAO. {ECO:0000269|PubMed:27021284}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00364DAPTransfer from AT3G18400Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAraha.9570s0009.1.p
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Repressed by the microRNA miR164. {ECO:0000269|PubMed:15294871, ECO:0000269|PubMed:17098808}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB0266580.0AB026658.1 Arabidopsis thaliana genomic DNA, chromosome 3, P1 clone: MYF24.
GenBankCP0026860.0CP002686.1 Arabidopsis thaliana chromosome 3, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002885255.10.0protein CUP-SHAPED COTYLEDON 2
SwissprotQ9FLJ24e-82NC100_ARATH; NAC domain-containing protein 100
TrEMBLA0A178VF420.0A0A178VF42_ARATH; NAC058
STRINGAl_scaffold_0003_19420.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM55272649
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18400.10.0NAC domain containing protein 58
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]