PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araha.9431s0002.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family NAC
Protein Properties Length: 403aa    MW: 46755.6 Da    PI: 6.7958
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araha.9431s0002.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM177.73.2e-5571351128
                  NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk..kvkaeek.ewyfFskrdkkyatgkrknratksgyWkatg 87 
                          +ppGfrFhPtdeelv++yL+kkv++k++e+ ++ik++d+yk+ePwdL++  k+ +ee+ ewyfFs++dkky+tg+r+nratk+g+Wkatg
  Araha.9431s0002.1.p   7 VPPGFRFHPTDEELVDYYLRKKVASKRIEI-DFIKDLDLYKIEPWDLQElcKIGNEEQsEWYFFSHKDKKYPTGTRTNRATKAGFWKATG 95 
                          69****************************.99**************954555554445******************************* PP

                  NAM  88 kdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                          +dk+++  +++l+g++ktLvfykgrap+g+k+dW+mheyr 
  Araha.9431s0002.1.p  96 RDKAIYI-RHSLIGMRKTLVFYKGRAPNGQKSDWIMHEYRS 135
                          *******.8899***************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.14E-595156IPR003441NAC domain
PROSITE profilePS5100558.5767156IPR003441NAC domain
PfamPF023652.8E-288134IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0048759Biological Processxylem vessel member cell differentiation
GO:1901348Biological Processpositive regulation of secondary cell wall biogenesis
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 403 aa     Download sequence    Send to blast
MNSFSQVPPG FRFHPTDEEL VDYYLRKKVA SKRIEIDFIK DLDLYKIEPW DLQELCKIGN  60
EEQSEWYFFS HKDKKYPTGT RTNRATKAGF WKATGRDKAI YIRHSLIGMR KTLVFYKGRA  120
PNGQKSDWIM HEYRSETNEN GTPQEEGWVV CRVFKKKLAA TVRKMGDYNS SPSHWYDDQL  180
SFMASELDSS SPRQFLTNHH YNRHHHHHQH TLPCGLNASS AYAFNNNNNP NLQCKQELEL  240
HYNHMVQHQQ QNHHLRESIF LQLPQLESPT SNCNSNNNNN TRNIGDLQKS SNISHEEQLQ  300
QGNQSFSTLY YDQGVEQMTT DWRVLDKFVA SQLSNEEAAA EASTSSHQNN VKIDTRNPAY  360
QVIDEGINLP ENDSERVVEM RDEYTNSHAA STSSSCQIDL WK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A4e-50715715169Stress-induced transcription factor NAC1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator that binds to the secondary wall NAC binding element (SNBE), 5'-(T/A)NN(C/T)(T/C/G)TNNNNNNNA(A/C)GN(A/C/T)(A/T)-3', in the promoter of target genes (By similarity). Involved in xylem formation by promoting the expression of secondary wall-associated transcription factors and of genes involved in secondary wall biosynthesis and programmed cell death, genes driven by the secondary wall NAC binding element (SNBE). Triggers thickening of secondary walls (PubMed:25148240). {ECO:0000250|UniProtKB:Q9LVA1, ECO:0000269|PubMed:25148240}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapAraha.9431s0002.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC0071900.0AC007190.4 Genomic sequence for Arabidopsis thaliana BAC F23N19 from chromosome I, complete sequence.
GenBankCP0026840.0CP002684.1 Arabidopsis thaliana chromosome 1 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002886460.10.0NAC domain-containing protein 26
RefseqXP_020865848.10.0NAC domain-containing protein 26
SwissprotF4HYV50.0NAC26_ARATH; NAC domain-containing protein 26
TrEMBLD7KU780.0D7KU78_ARALL; Uncharacterized protein
STRINGfgenesh2_kg.2__212__AT1G62700.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM21112678
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G62700.10.0Arabidopsis NAC domain containing protein 26
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]