PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araha.9072s0002.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family B3
Protein Properties Length: 437aa    MW: 49787.7 Da    PI: 9.9405
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araha.9072s0002.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B336.96.3e-122691894
                         --HHH.HTT---..--SEEEEEE.TTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EE CS
                   B3 18 lpkkfaeehggkkeesktltled.esgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvv 94
                         +pk f +++ +  +e+    l++  s  +W++k+  ++++    +tkGW+eF+  ++L++gD++vF+++g+    l++
  Araha.9072s0002.1.p  2 IPKAFYSKYLERRQEGNAAELRSeASEITWNIKI--DGRR----ITKGWEEFAVGHNLQVGDILVFRHEGN----LLF 69
                         9********5555567789999955669******..9998....9**********************7663....333 PP

2B346.95e-15123212697
                          ..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEE CS
                   B3   6 tpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvk 95 
                          +++++ +++ ++lp+ f+++ g++k ++ +++l+de+gr  ++kl+y k+ +r+  ++GW+ F++ ng k+g f+   l++ +++++v++
  Araha.9072s0002.1.p 123 VTASNQRLDSFYLPRGFTTSSGLSKLCN-EIILMDEKGRPSTLKLCYHKSTNRFCVSRGWRAFCRRNGFKTGCFLRPILVR-KGKTPVLR 210
                          5788899999*************99775.*******************************************988766665.67777777 PP

                          EE CS
                   B3  96 vf 97 
                          +f
  Araha.9072s0002.1.p 211 IF 212
                          76 PP

3B347.92.5e-15274363697
                          ..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEE CS
                   B3   6 tpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvk 95 
                          +++++ +++ + lpk+f+++ g++k + k++++ de+grs  + l+y+k+++r++ ++GW+ F+  ng k+g f+ + l++ +++++v++
  Araha.9072s0002.1.p 274 VTASNQRHDAFHLPKDFTTSSGLNKLC-KKIIFVDEKGRSSILDLSYDKSDNRFTVRRGWRAFCCRNGHKTGCFLRLILVR-NGKTPVLR 361
                          5788999999**************866.7**********************************************999998.67778998 PP

                          EE CS
                   B3  96 vf 97 
                          +f
  Araha.9072s0002.1.p 362 IF 363
                          87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5086312.478177IPR003340B3 DNA binding domain
SuperFamilySSF1019362.35E-13279IPR015300DNA-binding pseudobarrel domain
PfamPF023625.7E-8268IPR003340B3 DNA binding domain
CDDcd100172.72E-11274No hitNo description
SMARTSM010195.8E-7277IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.102.1E-14286IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.103.1E-14112209IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086310.292118215IPR003340B3 DNA binding domain
CDDcd100172.92E-15119213No hitNo description
SMARTSM010199.0E-18119215IPR003340B3 DNA binding domain
SuperFamilySSF1019362.35E-14119209IPR015300DNA-binding pseudobarrel domain
PfamPF023621.8E-13123212IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.102.8E-14267361IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS508639.812269366IPR003340B3 DNA binding domain
SuperFamilySSF1019367.06E-15269361IPR015300DNA-binding pseudobarrel domain
CDDcd100172.28E-12270363No hitNo description
SMARTSM010191.5E-16270366IPR003340B3 DNA binding domain
PfamPF023621.4E-13274363IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 437 aa     Download sequence    Send to blast
LIPKAFYSKY LERRQEGNAA ELRSEASEIT WNIKIDGRRI TKGWEEFAVG HNLQVGDILV  60
FRHEGNLLFH VTPFGLSCCE IIYSQNDEKD VKAKTGKVRR YRTVKKTAKN ESSSVDADFV  120
VPVTASNQRL DSFYLPRGFT TSSGLSKLCN EIILMDEKGR PSTLKLCYHK STNRFCVSRG  180
WRAFCRRNGF KTGCFLRPIL VRKGKTPVLR IFPLERDEDN IGNHSKKIKQ EVEHDTVKEE  240
TNVESGKLIR DRFVKKDAKN LCSSSYDTNF VVPVTASNQR HDAFHLPKDF TTSSGLNKLC  300
KKIIFVDEKG RSSILDLSYD KSDNRFTVRR GWRAFCCRNG HKTGCFLRLI LVRNGKTPVL  360
RIFTLEKDES SIGKNSKNIK QEVEHESSKE EKNVESLSLS DNSSFVVSVT VSNLREDILH  420
LSTTQLVQDG VAWDKK*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0026881e-104CP002688.1 Arabidopsis thaliana chromosome 5 sequence.
GenBankAB0464321e-104AB046432.1 Arabidopsis thaliana DNA, chromosome 5 centromere region, clone:F22D12.
GenBankF18O91e-104AF296831.1 Arabidopsis thaliana BAC F18O9.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001154745.10.0transcriptional factor B3 family protein
SwissprotF4KFT60.0REML3_ARATH; B3 domain-containing protein REM-like 3
TrEMBLR0F3W10.0R0F3W1_9BRAS; Uncharacterized protein
STRINGAT5G32460.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM17423910
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G32460.10.0B3 family protein